AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Aary5g02842 ATGGCAACACAAGCTTTGGTCTCATCATCATCACTCACATCCTCAGTTGAGTCTGCTAGACAAATCCTTGGTGCAAGACCAGCTTTCACACCTACAAGAAAAGTTTCATTTGTTGTCAAAGCTGCTTCCACCCCTCCTGTTAAGCAAGGAGACAGACAACTATGGTTTGCATCCAAGCAATCTCTTTCTTACCTGGATGGAACTCTCCCAGGTGACTTTGGATTCGACCCACTTGGTCTTTCCGACCCAGAAGGGACCGGAGGATTCATTGAACCCAAGTGGCTAGCTTATGGAGAGGTTATCAATGGACGGTTTGCCATGTTGGGTGCGGCCGGAGCTATTGCACCAGAAATTCTAGGCAAGCTTGGACTCATCCCAGCTGAAACTGCCCTTCCATGGTTCAAGACTGGTGTCATCCCCCCAGCTGGCACATACAACTACTGGGCTGACCCTTTCACCCTATTTGTATTAGAAATGGCACTTATGGGCTTTGCAGAACACAGAAGACTACAAGATTGGTACAACCCAGGATCAATGGGAAAACAATACTTTTTGGGTTTGGAAAAAGGGTTTTCAGGGTCAGGTGACCCAGCATACCCAGGTGGCCCGTTCTTTAACCCTCTTGGATTTGGGAAAGATGAGAAGTCGATGAAGGAATTGAAGCTAAAAGAGATCAAGAACGGTAGATTGGCTATGTTGGCTATCTTAGGTTACTTCATTCAGGGTTTGGTGACTGGGGTTGGACCTTTTCAGAACCTTTTGGATCATTTGGCTGATCCTGTCAACAACAATGTCTTGACCAGCCTTAAGTTCCACTAG 819 46.64 MATQALVSSSSLTSSVESARQILGARPAFTPTRKVSFVVKAASTPPVKQGDRQLWFASKQSLSYLDGTLPGDFGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEILGKLGLIPAETALPWFKTGVIPPAGTYNYWADPFTLFVLEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 272
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Aary5g02842 272 Gene3D Chlorophyll a-b binding protein domain 53 271 - -
Aary5g02842 272 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 4 267 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Aary5g02842 272 FunFam Chlorophyll a-b binding protein, chloroplastic 53 271 - -
Aary5g02842 272 SUPERFAMILY Chlorophyll a-b binding protein 51 268 - -
Aary5g02842 272 Pfam Chlorophyll A-B binding protein 63 242 IPR022796 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Aary5g02842 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Aary Aary-Chr5:172451300 Aary9g03152 Aary-Chr9:171119646 dispersed
Aary Aary-Chr13:197860161 Aary5g02842 Aary-Chr5:172451300 wgd
Aary Aary-Chr15:197636286 Aary5g02842 Aary-Chr5:172451300 wgd
Aary Aary-Chr5:172451300 Aary7g02535 Aary-Chr7:214792840 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Aary1g00753 ACH,AST 1 347 Chloroplast and Mitochondria gene family AT1G72820 67.435 2.82e-159 447.0
Aary1g00971 AST 2 305 Chloroplast and Mitochondria gene family AT2G47490 74.267 1.90e-156 438.0
Aary1g01420 AST 1 72 Chloroplast and Mitochondria gene family AT5G05370 69.444 1.22e-35 113.0
Aary1g01475 AST 5 327 Chloroplast and Mitochondria gene family AT2G30160 69.632 3.84e-158 444.0
Aary1g01484 . 5 327 Chloroplast and Mitochondria gene family AT2G30160 69.632 3.84e-158 444.0
Aary1g01596 AST 43 401 Chloroplast and Mitochondria gene family AT2G28800 77.898 0.0 600.0
Aary1g01924 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 84.758 8.75e-164 452.0
Aary1g02059 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.143 9.87e-48 160.0
Aary1g02066 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.786 4.47e-47 159.0
Aary1g02493 ACH,AST 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.817 0.0 511.0
Aary1g03039 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 81.667 9.31e-142 395.0
Aary1g03222 AST 37 310 Chloroplast and Mitochondria gene family AT1G25380 26.333 1.61e-29 114.0
Aary1g03502 AST 1 215 Chloroplast and Mitochondria gene family AT4G25570 67.593 4.37e-105 301.0
Aary2g00005 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 76.761 1.14e-169 472.0
Aary2g01070 AST 33 303 Chloroplast and Mitochondria gene family AT1G25380 28.904 4.96e-14 70.1
Aary2g01206 AST 5 304 Chloroplast and Mitochondria gene family AT2G17270 67.333 4.37e-154 432.0
Aary2g01466 ACH,AST 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.609 3.92e-149 415.0
Aary2g02091 AST 10 187 Chloroplast and Mitochondria gene family AT1G17530 64.088 1.18e-73 218.0
Aary2g02371 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.435 2.99e-167 468.0
Aary3g00107 AST 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.103 1.98e-171 479.0
Aary3g00416 . 70 367 Chloroplast and Mitochondria gene family AT5G14040 79.195 2.15e-178 498.0
Aary3g00608 . 38 255 Chloroplast and Mitochondria gene family AT3G61470 52.294 3.72e-75 227.0
Aary3g00870 . 38 251 Chloroplast and Mitochondria gene family AT3G61470 47.005 1.48e-62 196.0
Aary3g00911 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 85.663 6.86e-155 431.0
Aary3g01488 . 1 320 Chloroplast and Mitochondria gene family AT5G15640 76.875 0.0 511.0
Aary3g01757 AST 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.936 0.0 503.0
Aary4g00137 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.672 4.45e-164 455.0
Aary4g00776 . 6 214 Chloroplast and Mitochondria gene family AT4G25570 40.191 4.63e-55 174.0
Aary4g00805 . 6 214 Chloroplast and Mitochondria gene family AT4G25570 40.67 5.70e-56 176.0
Aary4g00988 ACH 6 214 Chloroplast and Mitochondria gene family AT4G25570 41.148 1.44e-56 177.0
Aary4g01036 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 5.89e-169 466.0
Aary5g00458 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 5.86e-173 476.0
Aary5g00459 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 5.86e-173 476.0
Aary5g00460 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 8.80e-173 475.0
Aary5g01863 AST 66 548 Chloroplast and Mitochondria gene family AT2G18710 84.886 0.0 835.0
Aary5g02080 . 150 207 Chloroplast and Mitochondria gene family AT2G28800 65.517 4.29e-20 84.7
Aary5g02144 AST 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 2.67e-34 110.0
Aary5g02842 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.281 3.13e-167 462.0
Aary5g03171 . 120 172 Chloroplast and Mitochondria gene family AT2G28800 45.283 4.41e-09 52.0
Aary6g01354 AST 25 390 Chloroplast and Mitochondria gene family AT4G21490 20.449 2.00e-06 48.5
Aary6g01380 AST 3 145 Chloroplast and Mitochondria gene family AT1G07020 51.389 8.02e-32 109.0
Aary7g00667 AST 5 354 Chloroplast and Mitochondria gene family AT5G54290 68.661 2.28e-148 421.0
Aary7g00674 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.98e-122 348.0
Aary7g00812 AST 1 369 Chloroplast and Mitochondria gene family AT5G14040 71.274 0.0 542.0
Aary7g01113 AST 34 255 Chloroplast and Mitochondria gene family AT3G61470 51.802 1.49e-74 225.0
Aary7g01595 AST 12 312 Chloroplast and Mitochondria gene family AT2G47490 27.635 4.82e-27 107.0
Aary7g01881 AST 29 300 Chloroplast and Mitochondria gene family AT2G47490 34.737 1.49e-40 142.0
Aary7g02101 . 2 228 Chloroplast and Mitochondria gene family AT5G38630 66.667 3.02e-109 312.0
Aary7g02376 ACH,AST 1 373 Chloroplast and Mitochondria gene family AT5G14040 77.273 0.0 573.0
Aary7g02466 ACH,AST 9 236 Chloroplast and Mitochondria gene family AT1G26100 64.557 7.36e-95 276.0
Aary7g02535 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 83.883 3.08e-164 454.0
Aary8g01304 AST 18 316 Chloroplast and Mitochondria gene family AT1G07030 29.568 4.82e-32 124.0
Aary8g02146 . 29 300 Chloroplast and Mitochondria gene family AT4G25700 68.75 6.53e-144 406.0
Aary9g00622 ACH 8 223 Chloroplast and Mitochondria gene family AT1G14730 59.259 1.04e-88 259.0
Aary9g00623 . 65 220 Chloroplast and Mitochondria gene family AT5G38630 26.282 1.47e-08 49.7
Aary9g00716 . 33 317 Chloroplast and Mitochondria gene family AT1G25380 66.319 1.43e-137 393.0
Aary9g00994 AST 72 404 Chloroplast and Mitochondria gene family AT2G28800 61.345 1.08e-151 441.0
Aary9g01549 AST 93 271 Chloroplast and Mitochondria gene family AT4G03320 40.217 6.61e-43 146.0
Aary9g02037 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.5 3.31e-144 401.0
Aary9g02315 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.395 1.73e-150 418.0
Aary9g02770 ACH,AST 17 305 Chloroplast and Mitochondria gene family AT2G17270 67.82 3.18e-157 439.0
Aary9g03152 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 90.135 5.44e-150 417.0
Aary9g03279 ACH,AST 1 187 Chloroplast and Mitochondria gene family AT1G17530 61.497 4.39e-72 214.0
Aary9g03560 AST 1 187 Chloroplast and Mitochondria gene family AT1G17530 61.497 4.39e-72 214.0
Aary10g00761 ACH 1 345 Chloroplast and Mitochondria gene family AT1G72820 66.667 2.64e-157 442.0
Aary10g00851 AST 1 347 Chloroplast and Mitochondria gene family AT1G72820 67.435 6.51e-160 449.0
Aary10g01076 AST 2 305 Chloroplast and Mitochondria gene family AT2G47490 75.244 4.80e-158 442.0
Aary10g01570 AST 1 72 Chloroplast and Mitochondria gene family AT5G05370 69.444 1.79e-35 113.0
Aary10g01615 AST 5 327 Chloroplast and Mitochondria gene family AT2G30160 69.632 2.95e-158 444.0
Aary10g01687 . 43 401 Chloroplast and Mitochondria gene family AT2G28800 77.957 0.0 600.0
Aary10g01690 AST 43 401 Chloroplast and Mitochondria gene family AT2G28800 77.957 0.0 597.0
Aary10g02317 . 38 325 Chloroplast and Mitochondria gene family AT1G76570 76.389 6.55e-171 476.0
Aary10g02441 AST 1 215 Chloroplast and Mitochondria gene family AT4G25570 67.593 1.38e-104 300.0
Aary10g02778 AST 37 310 Chloroplast and Mitochondria gene family AT1G25380 26.333 1.16e-29 114.0
Aary10g03208 AST 12 312 Chloroplast and Mitochondria gene family AT2G47490 27.714 5.54e-28 109.0
Aary10g03511 AST 33 303 Chloroplast and Mitochondria gene family AT1G25380 28.904 4.73e-14 70.1
Aary10g03699 AST 5 304 Chloroplast and Mitochondria gene family AT2G17270 67.333 2.51e-154 433.0
Aary10g03819 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.143 9.87e-48 160.0
Aary10g03912 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.143 9.87e-48 160.0
Aary10g04289 ACH 196 372 Chloroplast and Mitochondria gene family AT5G14040 85.311 3.65e-108 312.0
Aary10g04335 AST 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.852 0.0 508.0
Aary10g04578 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 69.737 9.75e-118 333.0
Aary10g04923 ACH,AST 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.609 3.92e-149 415.0
Aary10g05438 AST 10 187 Chloroplast and Mitochondria gene family AT1G17530 64.641 4.03e-74 219.0
Aary11g00106 AST 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.529 2.93e-170 476.0
Aary11g00824 . 38 255 Chloroplast and Mitochondria gene family AT3G61470 51.835 1.53e-74 225.0
Aary11g01046 . 38 251 Chloroplast and Mitochondria gene family AT3G61470 44.24 2.78e-52 169.0
Aary11g01171 . 32 280 Chloroplast and Mitochondria gene family AT4G10340 87.6 3.09e-145 408.0
Aary11g01172 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 85.663 6.86e-155 431.0
Aary11g01764 . 2 320 Chloroplast and Mitochondria gene family AT5G15640 77.116 0.0 508.0
Aary11g02048 ACH,AST 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.615 0.0 501.0
Aary12g00133 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.672 4.45e-164 455.0
Aary12g00201 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.672 4.55e-164 455.0
Aary12g00921 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 76.493 5.61e-140 391.0
Aary13g00894 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 8.80e-173 475.0
Aary13g01825 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 67.633 3.52e-103 299.0
Aary13g02370 AST 66 548 Chloroplast and Mitochondria gene family AT2G18710 84.886 0.0 834.0
Aary13g02619 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 9.23e-34 108.0
Aary13g02643 AST 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 1.51e-34 110.0
Aary13g03303 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.281 2.87e-167 462.0
Aary14g01569 AST 3 145 Chloroplast and Mitochondria gene family AT1G07020 51.389 3.62e-32 110.0
Aary15g00628 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.93e-122 348.0
Aary15g00637 ACH,AST 5 354 Chloroplast and Mitochondria gene family AT5G54290 67.521 4.28e-146 415.0
Aary15g00692 . 5 354 Chloroplast and Mitochondria gene family AT5G54290 68.091 2.98e-147 418.0
Aary15g00812 . 1 369 Chloroplast and Mitochondria gene family AT5G14040 71.274 0.0 542.0
Aary15g00991 AST 34 255 Chloroplast and Mitochondria gene family AT3G61470 51.802 1.34e-74 226.0
Aary15g01534 AST 12 312 Chloroplast and Mitochondria gene family AT2G47490 27.635 4.82e-27 107.0
Aary15g01812 AST 29 300 Chloroplast and Mitochondria gene family AT2G47490 35.664 1.91e-43 149.0
Aary15g02297 . 129 316 Chloroplast and Mitochondria gene family AT5G14040 54.787 1.90e-62 195.0
Aary15g02298 ACH,AST 1 373 Chloroplast and Mitochondria gene family AT5G14040 77.273 0.0 575.0
Aary15g02385 AST 9 236 Chloroplast and Mitochondria gene family AT1G26100 64.979 1.56e-95 278.0
Aary15g02428 . 33 319 Chloroplast and Mitochondria gene family AT1G25380 65.862 4.21e-139 396.0
Aary15g02507 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 90.189 0.0 498.0
Aary15g02508 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 1.07e-178 490.0
Aary15g02509 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 87.925 3.80e-178 489.0
Aary15g02510 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.057 3.40e-180 494.0
Aary15g02561 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 83.942 6.14e-165 456.0
Aary16g01273 AST 18 316 Chloroplast and Mitochondria gene family AT1G07030 29.568 3.02e-32 125.0
Aary16g01314 . 18 292 Chloroplast and Mitochondria gene family AT1G07030 30.325 3.53e-27 110.0
Aary16g02133 . 29 300 Chloroplast and Mitochondria gene family AT4G25700 67.007 1.09e-140 398.0
Aary17g00644 ACH 8 223 Chloroplast and Mitochondria gene family AT1G14730 59.722 1.38e-89 261.0
Aary17g00645 ACH 18 224 Chloroplast and Mitochondria gene family AT1G14730 44.976 5.62e-54 171.0
Aary17g00756 . 33 317 Chloroplast and Mitochondria gene family AT1G25380 66.319 2.63e-137 392.0
Aary17g01040 AST 72 404 Chloroplast and Mitochondria gene family AT2G28800 61.017 1.42e-153 445.0
Aary17g01401 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.448 1.14e-166 460.0
Aary17g01589 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 3.92e-171 471.0
Aary17g01590 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 1.45e-168 464.0
Aary17g01637 AST 93 271 Chloroplast and Mitochondria gene family AT4G03320 40.217 5.36e-43 145.0
Aary17g01671 . 93 271 Chloroplast and Mitochondria gene family AT4G03320 40.217 5.36e-43 145.0
Aary17g02709 ACH,AST 16 305 Chloroplast and Mitochondria gene family AT2G17270 67.586 1.18e-157 440.0
Aary17g03050 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 90.583 3.44e-150 418.0
Aary17g03177 ACH,AST 1 187 Chloroplast and Mitochondria gene family AT1G17530 61.497 5.58e-72 214.0