AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Amtr02g04154 ATGGCTGCCACTGCTAGCTCCACCACTGTGGTCCAAGCCACCCCCTTCTTGGGTCAAACTAGACCATCTAGCCTCAACCCCTTGAGAGATATGGTCTCTATGTCCAGTGCCAAATACACCATGGGAAATGATTTGTGGTATGGACCAGACCGTGTTAAGTACTTGGGACCCTTTTCGGCTCAGACTCCATCGTACTTGACCGGTGAATTCCCTGGTGACTACGGTTGGGACACCGCCGGTTTGTCAGCGGATCCCGAGGCTTTTGCCAAGAACCGGGCTCTTGAGGTTATCCATGGACGATGGGCCATGCTTGGTGCCCTCGGGTGCATCACACCCGAGGTGCTTGAAAAGTGGGTGAAAGTGGATTTCAAGGAACCAGTTTGGTTCAAGGCTGGCGCCCAGATTTTCTCTGAAGGCGGCCTAGACTACCTTGGGAACCCGAACCTTGTCCATGCTCAGAGCATATTGGCAGTTCTCGGGTTCCAGGTAGTCCTAATGGGCCTTGTTGAGGGGTTCCGTATCAACGGGCTTGAAGGGGTTGGAGATGGTAACAATTTGTACCCGGGTGGGCAATACTTTGACCCGCTGGGCCTTGCGGATGATCCAGTAACCTTTGCTGAGTTGAAGGTGAAAGAGATCAAGAACGGGAGACTGGCTATGTTTTCTATGTTTGGGTTCTTTGTGCAAGCAATAGTTACAGGCAAAGGCCCATTGGAGAACCTTTTGGACCATTTGGACAACCCTGTAGCTAACAATGCATGGGTCTACGCCACCAAGTTTGTGCCTGGCTCTTAG 795 52.08 MAATASSTTVVQATPFLGQTRPSSLNPLRDMVSMSSAKYTMGNDLWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWVKVDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLEGVGDGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGS 264
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Amtr02g04154 264 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 25 263 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Amtr02g04154 264 Pfam Chlorophyll A-B binding protein 63 231 IPR022796 -
Amtr02g04154 264 Gene3D Chlorophyll a-b binding protein domain 53 257 - -
Amtr02g04154 264 FunFam Chlorophyll a-b binding protein, chloroplastic 53 257 - -
Amtr02g04154 264 SUPERFAMILY Chlorophyll a-b binding protein 45 261 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Amtr02g04154 K08914 light-harvesting complex II chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Amtr Amtr-Chr2:82378777 Amtr03g03658 Amtr-Chr3:75799484 dispersed
Amtr Amtr-Chr2:82378777 Amtr07g01172 Amtr-Chr7:16073992 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Amtr01g02384 . 1 236 Chloroplast and Mitochondria gene family AT1G26100 63.265 9.66e-95 276.0
Amtr01g06275 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 8.16e-76 229.0
Amtr01g06578 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 71.935 0.0 542.0
Amtr01g06713 . 54 354 Chloroplast and Mitochondria gene family AT5G54290 77.076 5.41e-147 417.0
Amtr01g07159 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 64.017 2.61e-109 312.0
Amtr01g08173 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.194 5.56e-180 497.0
Amtr01g08385 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.544 5.89e-114 323.0
Amtr01g08722 . 33 308 Chloroplast and Mitochondria gene family AT1G25380 34.035 4.72e-44 152.0
Amtr01g09186 WGDA 33 300 Chloroplast and Mitochondria gene family AT1G25380 28.716 4.16e-14 70.5
Amtr02g00011 . 37 318 Chloroplast and Mitochondria gene family AT1G07030 32.042 2.98e-32 120.0
Amtr02g01144 . 33 327 Chloroplast and Mitochondria gene family AT1G25380 65.449 2.33e-142 405.0
Amtr02g02172 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.375 7.72e-150 417.0
Amtr02g03218 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.137 1.54e-167 469.0
Amtr02g03837 WGDA 33 294 Chloroplast and Mitochondria gene family AT1G25380 27.931 7.30e-13 66.6
Amtr02g04048 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 89.453 5.70e-171 471.0
Amtr02g04154 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 67.286 3.32e-123 350.0
Amtr02g04846 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 26.471 7.89e-29 112.0
Amtr02g05248 . 5 309 Chloroplast and Mitochondria gene family AT2G17270 64.918 6.81e-151 424.0
Amtr02g05550 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 2.09e-165 456.0
Amtr02g05549 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 4.64e-167 461.0
Amtr02g05548 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 3.20e-167 461.0
Amtr02g07076 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 83.871 1.82e-154 430.0
Amtr02g08142 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.434 0.0 497.0
Amtr03g01295 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 66.829 1.50e-101 295.0
Amtr03g02091 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 31.27 1.50e-33 129.0
Amtr03g02092 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 30.671 1.26e-33 129.0
Amtr03g03658 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.041 1.52e-121 345.0
Amtr03g04571 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 8.62e-76 229.0
Amtr03g05001 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 45.249 6.66e-60 189.0
Amtr03g05506 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 66.857 1.67e-166 466.0
Amtr03g05868 ACH 70 363 Chloroplast and Mitochondria gene family AT5G14040 80.952 0.0 506.0
Amtr03g06281 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.342 0.0 508.0
Amtr04g00316 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.61e-172 474.0
Amtr04g00317 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 2.44e-170 469.0
Amtr04g02092 . 43 548 Chloroplast and Mitochondria gene family AT2G18710 80.664 0.0 834.0
Amtr04g02800 ACH 1 71 Chloroplast and Mitochondria gene family AT5G05370 66.197 8.16e-33 106.0
Amtr04g02847 . 1 253 Chloroplast and Mitochondria gene family AT1G72820 61.66 4.06e-104 303.0
Amtr05g02957 ACH 5 111 Chloroplast and Mitochondria gene family AT5G14040 56.364 7.51e-31 110.0
Amtr05g02958 . 257 373 Chloroplast and Mitochondria gene family AT5G14040 81.197 3.43e-63 194.0
Amtr05g03670 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 72.802 0.0 536.0
Amtr05g05493 . 26 327 Chloroplast and Mitochondria gene family AT1G76570 76.49 6.67e-178 493.0
Amtr06g03332 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 89.453 7.26e-171 471.0
Amtr06g06182 . 6 143 Chloroplast and Mitochondria gene family AT1G07020 45.27 5.11e-28 99.8
Amtr07g00174 . 20 354 Chloroplast and Mitochondria gene family AT2G28800 20.282 3.92e-09 56.6
Amtr07g00620 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.991 4.69e-150 417.0
Amtr07g01172 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.811 0.0 497.0
Amtr07g03255 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.233 5.05e-148 412.0
Amtr07g04742 . 11 320 Chloroplast and Mitochondria gene family AT5G15640 70.0 8.49e-170 472.0
Amtr07g04743 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 73.248 2.59e-176 489.0
Amtr07g05107 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.74 0.0 505.0
Amtr08g00815 . 1 147 Chloroplast and Mitochondria gene family AT1G72820 64.865 3.74e-60 187.0
Amtr08g04028 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 75.806 0.0 567.0
Amtr08g04452 . 1 297 Chloroplast and Mitochondria gene family AT2G17270 68.35 1.53e-160 447.0
Amtr08g04718 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.54e-172 475.0
Amtr08g04719 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 2.67e-169 466.0
Amtr08g05593 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.482 7.83e-164 454.0
Amtr09g02535 . 36 407 Chloroplast and Mitochondria gene family AT2G28800 60.152 4.87e-158 457.0
Amtr09g03282 ACH 4 214 Chloroplast and Mitochondria gene family AT4G25570 44.076 3.18e-62 192.0
Amtr09g03283 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 59.375 5.30e-91 265.0
Amtr09g04015 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 83.333 2.11e-145 404.0
Amtr10g00428 WGDA 22 224 Chloroplast and Mitochondria gene family AT5G38630 40.887 7.75e-50 160.0
Amtr10g00602 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.567 3.58e-170 469.0
Amtr10g04619 ACH,WGDA 4 211 Chloroplast and Mitochondria gene family AT4G25570 44.231 7.31e-62 191.0
Amtr10g04814 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 1.15e-170 470.0
Amtr11g02644 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.93 2.93e-159 447.0
Amtr11g02932 . 4 271 Chloroplast and Mitochondria gene family AT4G03320 34.42 1.13e-42 145.0
Amtr11g03048 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.843 5.03e-150 417.0
Amtr11g03711 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.341 1.32e-158 446.0
Amtr11g03813 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 62.5 5.85e-71 211.0
Amtr11g03896 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 66.954 5.34e-158 444.0
Amtr11g04276 . 1 300 Chloroplast and Mitochondria gene family AT4G25700 65.528 2.30e-144 407.0
Amtr12g00303 . 33 300 Chloroplast and Mitochondria gene family AT2G47490 30.721 1.64e-30 116.0
Amtr12g00348 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 77.922 2.15e-166 463.0
Amtr12g01174 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 2.30e-33 107.0
Amtr12g01238 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 67.953 2.53e-162 454.0
Amtr12g01679 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 80.657 3.40e-158 440.0