AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Amtr07g06336 ATGGGTATCGATCTCATTGCAGGAGGTAAGAGCAAACGCACCAAAAGAACTGATCCAAGATCAGATGATATTTATTTAAAACTGCTTGTCAAGCTTTATAGGTTTTTGGTGAGGAGGACTGGAAGTAACTTTAATGCTGTGGTGTTGAAGAGGCTGTTTATGAGTAAAGTTAATAAGCCTCCTATTTCTTTGTCGAGGTTGATTCGTTACATGTCTGCCAAGGATGACAAGATTGCTGTGGTTGTCGGCACCGTCACAGACGATGTTAGGGTGCATGAAATCCCATGTCTCAAGGTAACTGCTTTGAGATTCACCGAGACCGCAAGGGCAAGGATCGAGAAGGCCGGTGGAGAATGTCTGACCTTTGATCAGCTGGCTCTTCGTGCCCCTCTTGGACAGAACACCGTTCTTCTTAGAGGTCCGAAGAACTCGCGTGAAGCTGTTAGGCACTTTGGTAAGGCTCCTGGTGTACCACACAGTCACACCAAGCCTTATGTGAGATCAAAGGGAAGGAAATTCGAAAAGGCGCGAGGTAGGAGGAACAGCAGGGGATTTAGAAACTAA 564 46.28 MGIDLIAGGKSKRTKRTDPRSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKPPISLSRLIRYMSAKDDKIAVVVGTVTDDVRVHEIPCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRN 187
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Amtr07g06336 187 FunFam 60S ribosomal protein L18 1 187 - -
Amtr07g06336 187 Gene3D - 1 187 - -
Amtr07g06336 187 MobiDBLite consensus disorder prediction 151 187 - -
Amtr07g06336 187 Pfam Ribosomal protein 60S L18 and 50S L18e 2 186 IPR021131 -
Amtr07g06336 187 SUPERFAMILY Ribosomal proteins L15p and L18e 21 139 IPR036227 -
Amtr07g06336 187 PANTHER 60S RIBOSOMAL PROTEIN L18 1 187 IPR000039 GO:0003723(PANTHER)|GO:0003735(InterPro)|GO:0003735(PANTHER)|GO:0005840(InterPro)|GO:0006412(InterPro)|GO:0022625(PANTHER)
Amtr07g06336 187 MobiDBLite consensus disorder prediction 164 187 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Amtr07g06336 K02883 large subunit ribosomal protein L18e
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
360836 Amtr07g06336 Amtr12g00378
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
208972 Amtr Amtr04g00755 Amtr-Chr4:11505734 Amtr07g06336 Amtr-Chr7:135217922
297360 Amtr Amtr12g00378 Amtr-Chr12:12737937 Amtr07g06336 Amtr-Chr7:135217922
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Amtr01g00689 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.316 1.37e-111 314.0
Amtr01g01775 . 50 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 31.897 1.90e-10 55.8
Amtr01g02058 . 92 159 Cytoplasmic Ribosomal Protein gene family AT5G48760 83.824 3.99e-37 122.0
Amtr01g02403 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 36.486 3.80e-08 50.1
Amtr01g02610 WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.84 3.83e-127 354.0
Amtr01g02874 WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.518 8.42e-152 421.0
Amtr01g02875 WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.518 1.31e-151 420.0
Amtr01g03000 ACH 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 9.31e-101 286.0
Amtr01g03394 . 79 177 Cytoplasmic Ribosomal Protein gene family AT2G42740 94.949 1.77e-67 198.0
Amtr01g04165 . 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 86.928 2.75e-93 265.0
Amtr01g04448 WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.247 6.77e-91 258.0
Amtr01g04447 . 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.247 1.21e-90 258.0
Amtr01g04489 . 23 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 31.878 9.53e-24 95.9
Amtr01g04491 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
Amtr01g04495 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
Amtr01g04499 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
Amtr01g04513 . 23 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 31.878 9.53e-24 95.9
Amtr01g04515 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
Amtr01g04520 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
Amtr01g04523 . 107 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 45.872 3.04e-20 84.3
Amtr01g04536 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
Amtr01g04538 . 107 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 45.872 3.04e-20 84.3
Amtr01g04586 . 28 137 Cytoplasmic Ribosomal Protein gene family AT3G11510 36.364 5.33e-14 63.2
Amtr01g05051 . 1 193 Cytoplasmic Ribosomal Protein gene family AT1G33140 83.42 6.83e-120 335.0
Amtr01g05136 . 23 79 Cytoplasmic Ribosomal Protein gene family AT3G06680 84.211 2.05e-31 102.0
Amtr01g05302 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.928 7.55e-93 264.0
Amtr01g06113 ACH 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.16 3.93e-171 470.0
Amtr01g06304 ACH,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.833 7.62e-76 218.0
Amtr01g06453 ACH 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 83.562 2.05e-91 259.0
Amtr01g06650 ACH 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 1.44e-64 191.0
Amtr01g06737 WGDA 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.86 0.0 495.0
Amtr01g06814 ACH,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.024 5.68e-128 359.0
Amtr01g06853 ACH 1 57 Cytoplasmic Ribosomal Protein gene family AT3G52590 36.842 2.00e-06 45.1
Amtr01g06967 WGDA 1 386 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.637 0.0 716.0
Amtr01g07032 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.028 1.46e-06 47.8
Amtr01g07055 . 25 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 88.889 9.85e-145 402.0
Amtr01g07256 ACH,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 4.20e-126 352.0
Amtr01g07419 ACH,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.964 9.13e-75 215.0
Amtr01g07530 ACH,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 1.83e-72 213.0
Amtr01g07538 ACH,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 1.82e-72 210.0
Amtr01g07733 ACH,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.24e-54 164.0
Amtr01g07876 ACH,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Amtr01g08100 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 66.667 6.20e-34 112.0
Amtr01g08113 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 90.278 4.87e-131 365.0
Amtr01g08631 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.132 3.31e-82 236.0
Amtr01g08869 WGDA 5 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 30.303 1.09e-06 46.2
Amtr01g09157 WGDA 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.361 1.67e-165 456.0
Amtr01g09168 . 2 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 81.728 0.0 676.0
Amtr01g09491 . 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 100.0 3.72e-50 155.0
Amtr01g09592 . 108 216 Cytoplasmic Ribosomal Protein gene family AT3G51190 42.478 2.88e-19 79.3
Amtr01g09595 . 28 137 Cytoplasmic Ribosomal Protein gene family AT3G52580 32.727 2.07e-12 58.9
Amtr02g00120 ACH 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 88.961 9.71e-76 221.0
Amtr02g00224 ACH,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.964 3.22e-75 216.0
Amtr02g01215 . 108 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 46.296 6.80e-21 83.6
Amtr02g01556 WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Amtr02g01926 . 157 193 Cytoplasmic Ribosomal Protein gene family AT5G10360 75.676 1.87e-12 57.8
Amtr02g02250 . 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 89.937 9.37e-98 277.0
Amtr02g02599 ACH 14 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 47.518 9.71e-36 119.0
Amtr02g02653 ACH,WGDA 9 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 86.441 7.41e-153 423.0
Amtr02g02825 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 3.77e-58 173.0
Amtr02g03018 WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT4G29410 73.239 3.96e-74 216.0
Amtr02g03056 . 87 151 Cytoplasmic Ribosomal Protein gene family AT1G29970 34.328 4.19e-08 46.6
Amtr02g03096 ACH,WGDA 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 81.673 5.26e-147 413.0
Amtr02g03255 . 85 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 34.722 6.46e-07 44.7
Amtr02g03436 ACH,WGDA 127 204 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.769 1.98e-06 43.5
Amtr02g03616 . 75 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 32.593 1.74e-08 49.3
Amtr02g03668 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 95.238 3.20e-70 203.0
Amtr02g03794 WGDA 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 89.96 3.92e-165 454.0
Amtr02g03912 . 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 100.0 4.08e-50 155.0
Amtr02g04077 ACH 21 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 45.652 1.45e-34 116.0
Amtr02g04195 WGDA 76 129 Cytoplasmic Ribosomal Protein gene family AT5G09490 42.593 6.01e-10 51.2
Amtr02g04455 WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 39.437 6.01e-07 43.5
Amtr02g04465 WGDA 30 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 39.394 1.28e-11 57.4
Amtr02g04559 ACH,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 87.963 4.05e-54 162.0
Amtr02g04585 ACH 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 82.222 7.87e-82 234.0
Amtr02g04681 ACH,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 1.20e-71 208.0
Amtr02g04686 ACH,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 4.65e-72 211.0
Amtr02g04734 . 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 84.81 1.54e-144 405.0
Amtr02g04795 ACH,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 92.857 1.63e-75 217.0
Amtr02g05033 ACH,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 4.20e-126 352.0
Amtr02g05113 ACH 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 87.013 6.94e-86 247.0
Amtr02g05268 WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 30.0 3.93e-07 47.8
Amtr02g05483 . 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Amtr02g05767 WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 75.524 2.13e-75 222.0
Amtr02g05958 . 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 57.6 1.01e-92 271.0
Amtr02g05980 ACH,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 2.02e-07 48.5
Amtr02g06013 . 108 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 46.296 8.47e-21 83.2
Amtr02g06598 WGDA 73 133 Cytoplasmic Ribosomal Protein gene family AT5G63070 42.623 2.81e-11 54.7
Amtr02g07316 ACH 127 199 Cytoplasmic Ribosomal Protein gene family AT2G47610 28.767 6.62e-06 43.1
Amtr02g07387 WGDA 1 139 Cytoplasmic Ribosomal Protein gene family AT5G61170 87.77 2.83e-92 261.0
Amtr02g07653 WGDA 24 121 Cytoplasmic Ribosomal Protein gene family AT5G62300 32.323 1.76e-08 49.7
Amtr02g07671 WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 84.058 1.19e-126 355.0
Amtr02g07995 WGDA 13 126 Cytoplasmic Ribosomal Protein gene family AT3G07110 30.303 1.36e-06 45.8
Amtr02g08227 . 185 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 57.534 1.95e-16 70.5
Amtr02g08288 . 68 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 88.608 4.09e-49 150.0
Amtr02g08451 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 7.84e-84 243.0
Amtr02g08534 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 5.06e-126 352.0
Amtr02g08769 . 108 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 46.296 8.47e-21 83.2
Amtr02g08869 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 3.01e-48 155.0
Amtr02g08870 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 96.104 1.17e-49 152.0
Amtr02g08872 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 97.403 3.84e-50 155.0
Amtr02g08873 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 97.403 2.43e-50 154.0
Amtr02g08876 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.12e-51 155.0
Amtr02g08877 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 5.01e-50 157.0
Amtr02g08987 . 12 141 Cytoplasmic Ribosomal Protein gene family AT4G09800 26.154 2.96e-06 42.0
Amtr03g00232 . 28 137 Cytoplasmic Ribosomal Protein gene family AT3G11510 34.545 1.59e-12 59.3
Amtr03g00383 . 17 45 Cytoplasmic Ribosomal Protein gene family AT1G52300 68.966 1.23e-08 46.6
Amtr03g01044 . 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 81.667 1.81e-69 202.0
Amtr03g01046 . 1 62 Cytoplasmic Ribosomal Protein gene family AT5G56670 95.161 1.22e-30 100.0
Amtr03g01304 . 1 72 Cytoplasmic Ribosomal Protein gene family AT1G23410 32.0 4.14e-06 41.6
Amtr03g01327 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 95.238 3.20e-70 203.0
Amtr03g01756 . 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 1.24e-117 331.0
Amtr03g01761 . 1 129 Cytoplasmic Ribosomal Protein gene family AT4G29430 75.194 3.92e-75 217.0
Amtr03g01866 WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 3.43e-58 172.0
Amtr03g02082 ACH 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.889 8.51e-09 53.1
Amtr03g02461 . 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Amtr03g02490 WGDA 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 80.272 1.01e-77 225.0
Amtr03g02575 ACH,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 83.537 6.56e-102 289.0
Amtr03g02619 ACH,WGDA 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 84.817 3.03e-125 350.0
Amtr03g03365 WGDA 1 386 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.637 0.0 716.0
Amtr03g03536 ACH,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.437 1.30e-127 358.0
Amtr03g03633 WGDA 97 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 85.802 1.13e-99 285.0
Amtr03g03908 ACH 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 86.301 2.63e-93 265.0
Amtr03g04592 ACH,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.833 3.24e-76 219.0
Amtr03g04700 WGDA 1 139 Cytoplasmic Ribosomal Protein gene family AT5G61170 86.331 1.20e-90 258.0
Amtr03g04756 ACH 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.77 7.03e-170 467.0
Amtr03g05209 . 1 28 Cytoplasmic Ribosomal Protein gene family AT2G25210 82.143 1.19e-08 48.1
Amtr03g05286 . 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.623 3.02e-80 229.0
Amtr03g05314 . 1 143 Cytoplasmic Ribosomal Protein gene family AT3G02080 81.119 1.67e-87 249.0
Amtr03g05410 . 9 211 Cytoplasmic Ribosomal Protein gene family AT2G27530 25.238 2.13e-06 46.6
Amtr03g05783 ACH 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.77 1.40e-64 192.0
Amtr03g05814 ACH,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 41.892 3.08e-06 45.1
Amtr03g05945 . 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 89.714 3.79e-118 330.0
Amtr03g06025 ACH 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 83.562 9.73e-91 258.0
Amtr03g06139 . 28 137 Cytoplasmic Ribosomal Protein gene family AT3G11510 36.364 5.33e-14 63.2
Amtr03g06755 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 65.217 7.93e-46 142.0
Amtr03g06982 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 77.037 1.23e-77 224.0
Amtr04g00016 ACH 1 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 41.333 2.58e-11 60.1
Amtr04g00211 ACH 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 93.377 8.03e-102 286.0
Amtr04g00407 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.636 4.65e-121 337.0
Amtr04g00581 WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Amtr04g00751 . 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.81 4.84e-125 350.0
Amtr04g00755 . 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 87.097 4.06e-122 341.0
Amtr04g00768 ACH,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 85.714 1.22e-62 185.0
Amtr04g00857 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 2.75e-85 243.0
Amtr04g00859 ACH,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Amtr04g00981 ACH,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 83.582 3.60e-79 228.0
Amtr04g01078 ACH,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 3.90e-137 380.0
Amtr04g01124 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 5.20e-84 240.0
Amtr04g01136 ACH,WGDA 1 62 Cytoplasmic Ribosomal Protein gene family AT5G56670 95.161 1.22e-30 100.0
Amtr04g01148 ACH,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 81.667 1.81e-69 202.0
Amtr04g01187 . 87 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 35.385 7.94e-07 44.3
Amtr04g01440 ACH,WGDA 1 121 Cytoplasmic Ribosomal Protein gene family AT3G47370 90.909 1.08e-78 226.0
Amtr04g01491 ACH,WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 97.656 5.78e-91 257.0
Amtr04g01611 ACH 1 124 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.581 5.44e-88 250.0
Amtr04g01810 . 1 287 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.003 9.87e-164 457.0
Amtr04g02264 ACH 1 51 Cytoplasmic Ribosomal Protein gene family AT4G31985 94.118 1.86e-31 101.0
Amtr04g02745 ACH,WGDA 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 81.849 0.0 501.0
Amtr04g03016 . 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.313 0.0 500.0
Amtr04g03099 WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 82.517 2.11e-89 254.0
Amtr04g03708 . 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 3.58e-50 150.0
Amtr04g04028 . 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 5.32e-118 332.0
Amtr04g04286 WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 87.368 1.24e-57 170.0
Amtr04g04415 . 1 86 Cytoplasmic Ribosomal Protein gene family AT3G47370 35.632 2.86e-09 53.1
Amtr04g05678 . 1 160 Cytoplasmic Ribosomal Protein gene family AT2G37190 85.0 3.75e-99 281.0
Amtr04g05699 ACH 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Amtr04g05757 WGDA 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 76.974 8.51e-77 223.0
Amtr04g05847 ACH,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 83.537 6.56e-102 289.0
Amtr04g05890 ACH,WGDA 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 2.23e-125 350.0
Amtr04g05947 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.544 2.79e-34 112.0
Amtr04g05948 ACH 1 73 Cytoplasmic Ribosomal Protein gene family AT3G44590 71.233 5.65e-30 102.0
Amtr05g00094 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 90.984 1.30e-73 213.0
Amtr05g00161 . 1 23 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.304 1.68e-08 50.8
Amtr05g00163 . 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 85.921 1.44e-176 489.0
Amtr05g00270 . 1 123 Cytoplasmic Ribosomal Protein gene family AT5G04800 83.2 2.55e-71 208.0
Amtr05g00288 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 87.963 9.96e-54 161.0
Amtr05g00311 ACH 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 79.259 5.15e-79 228.0
Amtr05g00417 ACH 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 90.196 1.78e-126 353.0
Amtr05g00483 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 63.793 1.63e-45 141.0
Amtr05g00500 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 1.56e-71 207.0
Amtr05g00562 ACH,WGDA 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 88.961 2.54e-86 248.0
Amtr05g00599 WGDA 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 3.30e-58 173.0
Amtr05g00616 WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 80.769 4.79e-82 239.0
Amtr05g00897 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 8.17e-166 456.0
Amtr05g01075 . 3 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 82.426 0.0 678.0
Amtr05g01136 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.105 7.51e-118 330.0
Amtr05g01456 . 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 82.877 5.19e-88 263.0
Amtr05g01457 . 2 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.828 1.00e-90 258.0
Amtr05g01816 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 69.027 1.01e-33 111.0
Amtr05g01820 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.815 6.20e-130 363.0
Amtr05g01838 ACH 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.864 3.04e-126 353.0
Amtr05g02639 ACH,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Amtr05g02864 ACH 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.157 2.22e-108 304.0
Amtr05g02934 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 70.796 3.20e-34 112.0
Amtr05g02945 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 90.278 7.39e-131 365.0
Amtr05g02967 ACH 1 64 Cytoplasmic Ribosomal Protein gene family AT5G64140 92.308 9.00e-37 115.0
Amtr05g03353 . 203 273 Cytoplasmic Ribosomal Protein gene family AT3G09200 63.38 1.68e-27 99.4
Amtr05g03907 WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 3.58e-50 150.0
Amtr05g03917 WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 79.646 3.54e-62 184.0
Amtr05g04465 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 3.62e-11 57.0
Amtr05g04658 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 85.547 2.15e-167 461.0
Amtr05g05566 WGDA 30 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 38.384 4.20e-10 53.5
Amtr05g05607 WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 4.95e-06 41.2
Amtr06g00092 . 1 387 Cytoplasmic Ribosomal Protein gene family AT1G61580 86.305 0.0 693.0
Amtr06g00250 . 69 154 Cytoplasmic Ribosomal Protein gene family AT2G39460 52.326 3.67e-22 86.3
Amtr06g00591 . 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 76.812 4.58e-31 105.0
Amtr06g00706 ACH 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 90.244 1.68e-79 228.0
Amtr06g00864 . 106 172 Cytoplasmic Ribosomal Protein gene family AT2G37270 70.149 1.44e-31 107.0
Amtr06g01027 ACH,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.923 2.27e-90 256.0
Amtr06g01273 ACH 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 6.44e-145 401.0
Amtr06g01345 ACH 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.962 1.02e-83 239.0
Amtr06g01537 ACH 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Amtr06g01538 WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Amtr06g01572 . 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.313 0.0 501.0
Amtr06g01678 ACH 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.81 6.37e-126 352.0
Amtr06g01723 ACH,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 88.0 2.92e-65 192.0
Amtr06g01823 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.806 4.41e-85 243.0
Amtr06g01825 ACH,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Amtr06g02039 ACH,WGDA 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 81.849 0.0 505.0
Amtr06g02042 . 1 51 Cytoplasmic Ribosomal Protein gene family AT4G31985 94.118 1.86e-31 101.0
Amtr06g02177 . 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 9.50e-93 262.0
Amtr06g02198 ACH,WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Amtr06g02230 ACH,WGDA 1 121 Cytoplasmic Ribosomal Protein gene family AT3G47370 90.083 4.51e-77 221.0
Amtr06g02234 . 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 84.81 1.41e-144 405.0
Amtr06g02436 ACH,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 81.667 1.81e-69 202.0
Amtr06g02448 ACH,WGDA 1 62 Cytoplasmic Ribosomal Protein gene family AT5G56670 95.161 1.22e-30 100.0
Amtr06g02453 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 82.707 1.58e-81 234.0
Amtr06g02472 ACH,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 2.43e-137 381.0
Amtr06g02506 ACH,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 85.821 8.36e-80 229.0
Amtr06g02659 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 61.062 6.67e-41 129.0
Amtr06g02805 ACH,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Amtr06g03237 . 15 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 42.069 2.03e-28 100.0
Amtr06g04052 . 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.317 1.31e-100 285.0
Amtr06g04439 WGDA 2 114 Cytoplasmic Ribosomal Protein gene family AT2G09990 75.221 6.28e-60 179.0
Amtr06g05072 . 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.405 1.31e-164 454.0
Amtr06g05099 . 1 261 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.272 0.0 498.0
Amtr06g05336 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Amtr06g05555 ACH,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 36.111 7.44e-09 53.1
Amtr06g05767 . 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 3.13e-121 338.0
Amtr06g05770 ACH 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 83.065 3.55e-61 181.0
Amtr06g05778 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.209 4.93e-92 261.0
Amtr06g05886 ACH,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Amtr06g06128 WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 92.754 6.73e-43 131.0
Amtr06g06318 . 8 132 Cytoplasmic Ribosomal Protein gene family AT2G42740 25.926 1.65e-06 45.4
Amtr07g00088 WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Amtr07g00094 . 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.641 1.58e-163 451.0
Amtr07g00297 ACH,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.889 5.77e-09 53.1
Amtr07g00322 WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 92.754 6.73e-43 131.0
Amtr07g00670 WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Amtr07g00919 . 1 56 Cytoplasmic Ribosomal Protein gene family AT4G33865 92.857 1.30e-34 109.0
Amtr07g01129 ACH 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 83.402 9.23e-151 418.0
Amtr07g01384 . 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 92.248 0.0 496.0
Amtr07g01483 ACH,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 84.466 1.25e-126 355.0
Amtr07g01498 WGDA 23 121 Cytoplasmic Ribosomal Protein gene family AT3G45030 31.0 1.05e-07 47.0
Amtr07g01871 . 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 2.19e-117 330.0
Amtr07g01989 . 1 37 Cytoplasmic Ribosomal Protein gene family AT1G08360 56.757 1.96e-06 43.5
Amtr07g02251 . 102 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 72.222 5.33e-41 132.0
Amtr07g02289 . 1 110 Cytoplasmic Ribosomal Protein gene family AT5G24510 59.091 1.27e-35 115.0
Amtr07g02346 WGDA 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.5 2.27e-93 265.0
Amtr07g02458 . 1 100 Cytoplasmic Ribosomal Protein gene family AT4G29410 74.0 7.95e-49 150.0
Amtr07g02486 WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 93.082 6.25e-98 277.0
Amtr07g02581 WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 89.286 1.62e-72 209.0
Amtr07g02610 ACH,WGDA 2 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.407 5.88e-59 173.0
Amtr07g02619 WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.641 2.22e-164 454.0
Amtr07g03359 . 21 213 Cytoplasmic Ribosomal Protein gene family AT3G11250 21.0 1.78e-09 55.1
Amtr07g03528 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 90.909 3.09e-43 139.0
Amtr07g03786 ACH 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 9.50e-93 262.0
Amtr07g04201 WGDA 1 110 Cytoplasmic Ribosomal Protein gene family AT3G56340 80.0 2.30e-60 180.0
Amtr07g04281 WGDA 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 81.507 0.0 499.0
Amtr07g04314 WGDA 53 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 90.123 2.98e-53 160.0
Amtr07g04393 ACH,WGDA 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 86.26 7.44e-79 227.0
Amtr07g04421 ACH 41 184 Cytoplasmic Ribosomal Protein gene family AT2G47610 85.417 1.73e-89 260.0
Amtr07g04422 . 41 184 Cytoplasmic Ribosomal Protein gene family AT2G47610 85.417 1.73e-89 260.0
Amtr07g04564 ACH 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Amtr07g04812 WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT3G02080 81.818 1.63e-88 252.0
Amtr07g05133 ACH 1 64 Cytoplasmic Ribosomal Protein gene family AT5G64140 92.308 9.00e-37 115.0
Amtr07g05210 . 1 56 Cytoplasmic Ribosomal Protein gene family AT4G33865 91.071 2.03e-34 108.0
Amtr07g05747 ACH 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 78.146 1.17e-79 230.0
Amtr07g06165 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 82.833 1.06e-124 351.0
Amtr07g06336 WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 85.484 4.40e-119 333.0
Amtr07g06343 ACH,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 82.791 2.93e-124 348.0
Amtr08g00094 ACH 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 81.275 1.34e-150 422.0
Amtr08g00421 ACH 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 7.80e-65 192.0
Amtr08g00649 WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 3.58e-50 150.0
Amtr08g00658 WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 79.646 1.26e-62 186.0
Amtr08g00659 . 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 79.646 2.44e-63 187.0
Amtr08g01175 ACH 127 195 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.435 5.84e-06 42.7
Amtr08g01231 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.549 3.68e-170 468.0
Amtr08g01618 . 85 172 Cytoplasmic Ribosomal Protein gene family AT2G37270 52.273 2.71e-22 84.7
Amtr08g01694 WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.923 2.85e-91 258.0
Amtr08g02021 . 2 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 68.966 1.25e-67 199.0
Amtr08g02238 . 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 84.81 1.30e-145 407.0
Amtr08g02396 . 1 219 Cytoplasmic Ribosomal Protein gene family AT1G26910 86.758 4.99e-143 396.0
Amtr08g03204 WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 75.393 2.51e-110 311.0
Amtr08g03343 . 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 75.393 2.51e-110 311.0
Amtr08g04010 ACH 1 64 Cytoplasmic Ribosomal Protein gene family AT5G64140 92.308 9.00e-37 115.0
Amtr08g04188 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 36.486 1.34e-08 51.2
Amtr08g04345 WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Amtr08g04463 . 5 81 Cytoplasmic Ribosomal Protein gene family AT3G52590 29.87 5.18e-06 44.3
Amtr08g04586 WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.518 6.49e-152 421.0
Amtr08g04587 WGDA 1 250 Cytoplasmic Ribosomal Protein gene family AT2G31610 82.47 1.98e-146 407.0
Amtr08g04779 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 1.10e-119 334.0
Amtr08g04780 . 10 151 Cytoplasmic Ribosomal Protein gene family AT1G29970 46.104 2.95e-32 111.0
Amtr08g04939 ACH,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT4G18730 93.333 1.69e-126 351.0
Amtr08g05056 . 96 251 Cytoplasmic Ribosomal Protein gene family AT2G41840 29.091 9.88e-15 71.2
Amtr08g05122 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 5.39e-47 157.0
Amtr08g05341 . 2 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 55.263 3.66e-18 74.7
Amtr08g05357 ACH,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Amtr08g05432 ACH,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Amtr08g05434 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.806 4.41e-85 243.0
Amtr08g05492 ACH,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 84.677 1.35e-61 182.0
Amtr09g00041 . 1 82 Cytoplasmic Ribosomal Protein gene family AT3G52590 39.024 1.21e-09 55.1
Amtr09g00046 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.632 8.96e-118 330.0
Amtr09g00070 . 23 82 Cytoplasmic Ribosomal Protein gene family AT3G06680 80.0 5.09e-31 101.0
Amtr09g00109 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 5.28e-47 157.0
Amtr09g00108 . 1 73 Cytoplasmic Ribosomal Protein gene family AT3G52590 94.521 1.51e-45 140.0
Amtr09g00151 . 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 7.51e-58 171.0
Amtr09g00251 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.09e-47 156.0
Amtr09g00428 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 74.667 2.57e-31 115.0
Amtr09g00431 . 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 71.053 4.51e-30 111.0
Amtr09g00433 . 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 66.667 2.59e-23 92.8
Amtr09g00440 . 9 79 Cytoplasmic Ribosomal Protein gene family AT3G52590 46.479 1.54e-11 58.5
Amtr09g00448 . 1 78 Cytoplasmic Ribosomal Protein gene family AT3G52590 76.923 1.38e-34 123.0
Amtr09g00449 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 48.0 3.96e-14 67.4
Amtr09g00450 . 1 73 Cytoplasmic Ribosomal Protein gene family AT3G52590 65.753 1.28e-25 99.4
Amtr09g00451 . 1 73 Cytoplasmic Ribosomal Protein gene family AT3G52590 71.233 7.62e-28 105.0
Amtr09g00453 . 1 78 Cytoplasmic Ribosomal Protein gene family AT3G52590 51.136 6.84e-21 86.3
Amtr09g00455 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 73.333 6.30e-30 109.0
Amtr09g00456 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 60.0 4.42e-23 89.4
Amtr09g00474 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 60.0 2.06e-22 90.5
Amtr09g00476 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G62250 48.0 1.25e-16 75.1
Amtr09g00589 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 90.278 8.80e-131 365.0
Amtr09g00604 ACH 1 69 Cytoplasmic Ribosomal Protein gene family AT3G44590 63.768 3.16e-24 87.4
Amtr09g00753 ACH 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.157 2.22e-108 304.0
Amtr09g01213 . 99 216 Cytoplasmic Ribosomal Protein gene family AT3G51190 40.678 2.60e-22 89.0
Amtr09g01799 ACH 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 82.833 5.56e-126 354.0
Amtr09g02588 . 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 89.831 1.45e-118 331.0
Amtr09g02712 ACH,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 95.349 2.21e-59 174.0
Amtr09g02722 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 1.79e-77 222.0
Amtr09g02735 . 1 218 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.156 2.06e-145 402.0
Amtr09g02812 . 84 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 44.118 2.71e-06 45.1
Amtr09g03035 . 1 114 Cytoplasmic Ribosomal Protein gene family AT4G27090 80.702 4.81e-64 189.0
Amtr09g03550 . 110 172 Cytoplasmic Ribosomal Protein gene family AT2G37270 79.365 4.69e-33 110.0
Amtr09g03648 . 56 110 Cytoplasmic Ribosomal Protein gene family AT2G40010 47.273 1.30e-11 56.6
Amtr09g03685 . 5 110 Cytoplasmic Ribosomal Protein gene family AT2G40010 41.667 1.97e-21 85.9
Amtr09g03827 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Amtr09g03866 . 28 125 Cytoplasmic Ribosomal Protein gene family AT3G11510 36.735 1.97e-10 53.1
Amtr09g03877 ACH 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 5.92e-81 232.0
Amtr09g04089 . 79 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 90.196 5.60e-68 200.0
Amtr09g04102 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 4.74e-72 209.0
Amtr09g04274 ACH,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.964 3.22e-75 216.0
Amtr09g04511 ACH 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 4.20e-126 352.0
Amtr09g04705 ACH 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 87.582 4.65e-88 253.0
Amtr09g04788 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 81.41 1.70e-83 242.0
Amtr09g05056 WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT5G67510 77.703 3.69e-80 231.0
Amtr09g05149 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Amtr10g00062 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Amtr10g00141 . 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Amtr10g00145 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 3.19e-77 222.0
Amtr10g00604 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 87.5 1.68e-119 333.0
Amtr10g00831 . 8 105 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.776 1.81e-57 171.0
Amtr10g00976 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 58.772 1.64e-37 120.0
Amtr10g01071 ACH,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 2.04e-101 285.0
Amtr10g01159 ACH,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.545 1.00e-123 348.0
Amtr10g01291 ACH 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Amtr10g01544 . 1 100 Cytoplasmic Ribosomal Protein gene family AT4G29410 74.0 7.95e-49 150.0
Amtr10g01634 ACH 1 74 Cytoplasmic Ribosomal Protein gene family AT3G62250 38.667 5.75e-10 57.0
Amtr10g01783 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 5.51e-47 157.0
Amtr10g03741 ACH 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 82.403 9.47e-124 348.0
Amtr10g03813 ACH,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 3.46e-101 285.0
Amtr10g03864 . 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.132 3.31e-82 236.0
Amtr10g03914 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 62.832 3.65e-42 132.0
Amtr10g03922 . 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Amtr10g04062 . 1 153 Cytoplasmic Ribosomal Protein gene family AT1G23410 91.503 1.05e-89 257.0
Amtr10g04232 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.78e-78 224.0
Amtr10g04235 . 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.07e-125 350.0
Amtr10g04815 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 3.31e-120 335.0
Amtr10g04965 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 3.77e-58 173.0
Amtr11g00269 . 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 89.714 1.92e-118 330.0
Amtr11g00813 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 95.652 1.12e-43 133.0
Amtr11g01241 WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.26 2.86e-162 448.0
Amtr11g01255 WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Amtr11g01296 WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 89.286 1.62e-72 209.0
Amtr11g01399 WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 91.824 1.12e-97 276.0
Amtr11g01625 WGDA 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 88.158 6.21e-95 269.0
Amtr11g01750 . 108 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 38.889 3.51e-12 59.3
Amtr11g01911 . 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 85.56 1.37e-175 487.0
Amtr11g02242 ACH 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 5.76e-06 42.4
Amtr11g02402 . 1 51 Cytoplasmic Ribosomal Protein gene family AT3G02190 94.118 4.94e-31 100.0
Amtr11g02468 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 95.238 1.91e-70 205.0
Amtr11g02929 . 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Amtr11g03085 . 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 89.937 9.37e-98 277.0
Amtr11g03236 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 91.667 5.68e-56 167.0
Amtr11g03281 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.209 4.93e-92 261.0
Amtr11g03296 ACH,WGDA 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 84.647 2.62e-152 422.0
Amtr11g03410 ACH,WGDA 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 3.10e-06 43.1
Amtr11g03492 . 1 139 Cytoplasmic Ribosomal Protein gene family AT2G44860 78.417 2.16e-82 238.0
Amtr11g03582 ACH 1 51 Cytoplasmic Ribosomal Protein gene family AT4G31985 94.118 1.86e-31 101.0
Amtr11g03619 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 95.238 3.20e-70 203.0
Amtr11g03725 . 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.932 1.47e-91 260.0
Amtr11g03790 ACH,WGDA 12 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 83.74 2.15e-148 416.0
Amtr11g03837 WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT4G29410 71.831 4.56e-73 213.0
Amtr11g03860 . 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 1.75e-57 170.0
Amtr11g03948 . 85 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 36.111 6.95e-08 47.0
Amtr11g04051 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 1.56e-71 207.0
Amtr11g04100 ACH 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 4.20e-126 352.0
Amtr11g04227 ACH,WGDA 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 87.662 7.58e-86 247.0
Amtr11g04253 WGDA 1 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 83.962 1.37e-58 174.0
Amtr11g04277 WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 81.41 2.07e-82 239.0
Amtr12g00145 . 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 85.921 1.44e-176 489.0
Amtr12g00354 WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.568 1.10e-125 352.0
Amtr12g00378 WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.559 2.25e-120 336.0
Amtr12g00904 . 1 28 Cytoplasmic Ribosomal Protein gene family AT2G25210 82.143 1.19e-08 48.1
Amtr12g00991 ACH,WGDA 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 85.496 5.48e-78 225.0
Amtr12g01007 ACH 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Amtr12g01062 ACH 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 1.36e-137 381.0
Amtr12g01108 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 2.41e-84 241.0
Amtr12g01140 ACH,WGDA 1 294 Cytoplasmic Ribosomal Protein gene family AT3G25520 80.272 0.0 498.0
Amtr12g01176 ACH 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 4.34e-145 401.0
Amtr12g01191 WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 80.531 1.33e-62 186.0
Amtr12g01588 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 93.443 1.12e-81 233.0
Amtr12g01657 ACH 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.06 7.99e-84 239.0