AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bial12g02740 ATGCCAGGGTATCGATCTCATTGCCGGAGGACTGGAAGCAACTTCAATGCTGTCATATTGAAGAGGCTCTTCATGAGCAAAGTCAATAAGCCTCCGATTTCACTTTCTCGCCTTATTCGTTACATGTCCGCCAAGGATGACAAGATTGCTGTGGTTGTGGGAACTGTTACCGATGATGTTAGGGTGCATGAAATCCCTTGCCTCAAGGTTGCCGCACTGAGGTTTACGGAGACTGCCAGGGCAAGGATCGAGAAAGCTGGTGGTGAGTGTCTGACCTTTGACCAGCTGGCCCTTCGAGCTCCTCTTGGCCAGAACACGGTTCTTTTAAGAGGTCCAAAGAGCCGTGAAGCACTTAAGCATATGGGTCCAGCTCCTGGTGTACCACACAGTCACACCAAGCCGTATGTGAGGTCAAAGGGAAGGAAGTTTGAGAAGGCCAGAGGGAGAAGGAACAGCAGGGGATTTAGAAACTAA 474 50.21 MPGYRSHCRRTGSNFNAVILKRLFMSKVNKPPISLSRLIRYMSAKDDKIAVVVGTVTDDVRVHEIPCLKVAALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKSREALKHMGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRN 157
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Bial12g02740 157 SUPERFAMILY Ribosomal proteins L15p and L18e 4 110 IPR036227 -
Bial12g02740 157 Gene3D - 2 157 - -
Bial12g02740 157 MobiDBLite consensus disorder prediction 117 157 - -
Bial12g02740 157 FunFam 60S ribosomal protein L18 2 157 - -
Bial12g02740 157 PANTHER 60S RIBOSOMAL PROTEIN L18 4 157 IPR000039 GO:0003723(PANTHER)|GO:0003735(PANTHER)|GO:0003735(InterPro)|GO:0005840(InterPro)|GO:0006412(InterPro)|GO:0022625(PANTHER)
Bial12g02740 157 MobiDBLite consensus disorder prediction 134 157 - -
Bial12g02740 157 Pfam Ribosomal protein 60S L18 and 50S L18e 4 156 IPR021131 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bial12g02740 K02883 large subunit ribosomal protein L18e
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
184896 Bial12g02740 Bial24g02585
361550 Bial10g01308 Bial12g02740
363622 Bial12g02740 Bial24g02585
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
677959 Bial Bial12g02740 Bial-Chr12:57513700 Bial4g00980 Bial-Chr4:12000226
777571 Bial Bial10g01308 Bial-Chr10:13037815 Bial12g02740 Bial-Chr12:57513700
794759 Bial Bial12g02740 Bial-Chr12:57513700 Bial24g02585 Bial-Chr24:56642522
797904 Bial Bial12g02740 Bial-Chr12:57513700 Bial7g02456 Bial-Chr7:58838897
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bial10g03807 . 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 5.63e-58 171.0
Bial10g03702 BST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.77 1.60e-118 337.0
Bial12g01136 BST,WGDA 46 154 Cytoplasmic Ribosomal Protein gene family AT2G39460 43.363 8.45e-21 82.8
Bial15g00108 ACH,BST 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 85.0 5.41e-72 208.0
Bial4g01283 ACH,BST,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 78.151 9.69e-61 201.0
Bial4g01222 ACH,BST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.835 3.34e-138 383.0
Bial18g01857 . 176 238 Cytoplasmic Ribosomal Protein gene family AT5G10360 84.127 4.79e-28 101.0
Bial18g02010 BST,WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G62250 30.0 5.62e-07 44.3
Bial18g02087 . 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.518 1.58e-145 428.0
Bial24g00608 BST,WGDA 3 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 81.683 0.0 672.0
Bial12g00466 BST,WGDA 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 87.879 1.09e-56 171.0
Bial12g00481 ACH,BST,WGDA 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 87.662 1.42e-86 249.0
Bial12g00524 ACH 87 198 Cytoplasmic Ribosomal Protein gene family AT4G16720 84.821 9.85e-69 203.0
Bial12g00565 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.177 2.19e-39 125.0
Bial3g01136 BST 19 213 Cytoplasmic Ribosomal Protein gene family AT3G11250 20.792 1.08e-08 52.8
Bial14g00266 BST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 73.427 3.19e-73 214.0
Bial14g00226 BST,WGDA 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 79.842 6.84e-146 410.0
Bial2g00102 . 1 139 Cytoplasmic Ribosomal Protein gene family AT2G44860 77.698 1.69e-81 236.0
Bial13g02484 ACH,BST,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 84.541 4.58e-127 357.0
Bial13g02467 BST,WGDA 23 121 Cytoplasmic Ribosomal Protein gene family AT5G62300 31.0 1.92e-07 48.5
Bial18g03098 ACH,BST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.889 4.45e-10 56.6
Bial18g02906 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.023 5.23e-164 452.0
Bial18g02792 ACH 1 66 Cytoplasmic Ribosomal Protein gene family AT3G59540 92.424 1.03e-40 125.0
Bial18g02372 . 2 47 Cytoplasmic Ribosomal Protein gene family AT3G61110 80.435 4.11e-21 79.7
Bial18g02340 BST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 89.286 1.35e-148 412.0
Bial2g00182 ACH,BST,WGDA 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 3.10e-06 43.1
Bial2g00308 ACH,BST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Bial2g00497 ACH,BST,WGDA 7 254 Cytoplasmic Ribosomal Protein gene family AT1G72370 78.8 6.10e-142 400.0
Bial2g00542 ACH,BST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 73.427 3.19e-73 214.0
Bial2g00649 ACH,BST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 43.226 1.49e-34 116.0
Bial2g00667 ACH,BST,WGDA 1 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 83.607 9.26e-154 425.0
Bial2g00673 BST,WGDA 60 139 Cytoplasmic Ribosomal Protein gene family AT3G11510 92.5 1.26e-47 156.0
Bial2g00704 BST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 90.741 1.01e-55 166.0
Bial2g00741 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.932 5.34e-91 259.0
Bial2g00945 BST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Bial2g01094 BST,WGDA 1 387 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.922 0.0 722.0
Bial2g01203 ACH,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.78 1.00e-127 358.0
Bial2g01252 ACH,BST,WGDA 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.473 4.71e-180 493.0
Bial2g01299 ACH,BST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 1.33e-64 193.0
Bial2g01332 BST,WGDA 56 143 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.182 2.47e-58 175.0
Bial2g01366 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 87.671 3.08e-92 262.0
Bial2g01443 BST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.0 1.05e-75 218.0
Bial2g01513 ACH,BST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.16 1.08e-170 471.0
Bial2g02030 . 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 75.916 2.01e-110 311.0
Bial2g02277 ACH,BST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 81.675 2.71e-113 322.0
Bial8g02508 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.549 3.60e-172 473.0
Bial8g02329 . 143 166 Cytoplasmic Ribosomal Protein gene family AT1G33140 87.5 1.03e-07 45.1
Bial12g00939 BST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 81.818 7.15e-89 253.0
Bial12g00657 BST,WGDA 3 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 81.683 0.0 673.0
Bial24g00243 . 164 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 70.455 2.86e-30 109.0
Bial24g00433 BST,WGDA 5 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 87.255 5.54e-58 175.0
Bial4g02093 . 164 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 67.045 2.83e-28 104.0
Bial3g03833 ACH,BST,WGDA 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 7.07e-06 42.7
Bial3g03754 . 1 47 Cytoplasmic Ribosomal Protein gene family AT4G31985 78.723 1.81e-23 82.0
Bial3g03664 ACH,BST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 93.333 1.12e-68 199.0
Bial3g03448 ACH,BST,WGDA 7 254 Cytoplasmic Ribosomal Protein gene family AT1G72370 80.8 7.31e-147 412.0
Bial3g03407 . 87 151 Cytoplasmic Ribosomal Protein gene family AT1G29970 34.328 2.57e-07 44.3
Bial3g03376 ACH,BST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 74.126 1.53e-75 219.0
Bial3g03185 ACH,BST,WGDA 6 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 42.073 6.19e-33 112.0
Bial3g03155 ACH,BST,WGDA 95 242 Cytoplasmic Ribosomal Protein gene family AT2G44120 89.865 1.74e-98 281.0
Bial3g03154 . 4 93 Cytoplasmic Ribosomal Protein gene family AT3G13580 76.667 5.92e-42 135.0
Bial3g02969 ACH,BST,WGDA 6 140 Cytoplasmic Ribosomal Protein gene family AT2G09990 85.926 1.41e-85 247.0
Bial3g02878 ACH,BST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.05 4.12e-96 273.0
Bial18g01372 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.57e-48 156.0
Bial18g01259 ACH,BST,WGDA 1 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.0 1.97e-10 57.8
Bial24g00906 BST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 81.818 7.15e-89 253.0
Bial9g00396 WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Bial9g00348 . 15 128 Cytoplasmic Ribosomal Protein gene family AT4G18730 28.226 1.04e-06 46.2
Bial9g00201 BST 22 91 Cytoplasmic Ribosomal Protein gene family AT5G24510 54.286 6.39e-20 75.5
Bial9g00200 . 13 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 56.863 4.86e-31 104.0
Bial3g01832 ACH,BST,WGDA 1 185 Cytoplasmic Ribosomal Protein gene family AT3G49010 54.595 1.13e-56 182.0
Bial3g01834 ACH,BST,WGDA 66 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 79.365 1.60e-70 209.0
Bial3g02336 ACH,BST,WGDA 1 165 Cytoplasmic Ribosomal Protein gene family AT4G34670 81.818 3.44e-90 262.0
Bial3g02515 ACH,BST 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 83.663 9.19e-122 340.0
Bial8g03211 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.889 9.71e-07 48.1
Bial8g03218 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 5.32e-166 457.0
Bial8g01318 . 14 142 Cytoplasmic Ribosomal Protein gene family AT3G04230 28.244 9.93e-07 46.2
Bial8g01132 ACH,BST 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 88.961 3.04e-76 222.0
Bial1g01877 ACH 2 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 95.588 1.51e-43 133.0
Bial8g01329 . 14 142 Cytoplasmic Ribosomal Protein gene family AT3G04230 28.244 1.33e-06 45.8
Bial8g01414 BST 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 1.40e-125 351.0
Bial8g00121 . 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.96 8.84e-120 334.0
Bial8g00271 . 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 95.349 2.21e-59 174.0
Bial8g00297 . 102 218 Cytoplasmic Ribosomal Protein gene family AT1G26910 85.47 1.35e-70 209.0
Bial22g00340 ACH,BST 57 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 92.424 1.92e-37 121.0
Bial22g00346 ACH,BST,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.662 5.55e-73 214.0
Bial22g00412 ACH,BST 1 81 Cytoplasmic Ribosomal Protein gene family AT1G74270 90.123 4.16e-51 154.0
Bial22g00542 ACH,BST 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 88.725 3.45e-125 350.0
Bial22g00587 ACH,BST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 62.987 1.77e-48 151.0
Bial6g00136 BST 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 80.606 1.03e-89 256.0
Bial6g00164 ACH,BST 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 6.10e-146 408.0
Bial6g00172 ACH,BST,WGDA 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 91.057 2.07e-80 233.0
Bial6g00221 . 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Bial6g00415 BST,WGDA 3 171 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.757 9.27e-115 322.0
Bial6g00623 BST,WGDA 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 2.19e-56 175.0
Bial12g03730 BST 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 91.803 3.45e-79 227.0
Bial12g01591 BST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 79.581 6.80e-114 320.0
Bial12g01534 BST,WGDA 4 120 Cytoplasmic Ribosomal Protein gene family AT5G61170 88.889 3.73e-77 223.0
Bial12g02211 BST,WGDA 1 387 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.664 0.0 719.0
Bial12g02272 BST,WGDA 76 129 Cytoplasmic Ribosomal Protein gene family AT5G09490 40.741 6.53e-09 50.1
Bial12g02370 ACH,BST,WGDA 1 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 42.767 6.29e-35 117.0
Bial12g02562 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.247 7.76e-90 256.0
Bial12g02616 BST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 5.01e-137 382.0
Bial12g02694 BST,WGDA 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 86.26 5.24e-79 227.0
Bial12g02700 BST,WGDA 16 139 Cytoplasmic Ribosomal Protein gene family AT3G04400 99.194 5.72e-88 253.0
Bial12g02709 BST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Bial12g02735 ACH,BST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.434 2.21e-125 351.0
Bial12g02740 BST,WGDA 33 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 82.468 1.23e-91 262.0
Bial12g02791 BST,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.974 3.50e-124 350.0
Bial12g02805 BST,WGDA 8 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 82.609 2.65e-38 121.0
Bial19g03336 ACH,BST,WGDA 25 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 81.377 4.76e-138 388.0
Bial19g03150 ACH,BST,WGDA 25 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.333 9.19e-65 191.0
Bial19g03069 . 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 78.761 1.52e-61 183.0
Bial19g03061 . 18 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 81.25 1.49e-35 113.0
Bial15g03361 BST,WGDA 127 204 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.769 1.98e-06 43.5
Bial13g02849 BST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 92.754 5.00e-43 131.0
Bial24g01559 BST,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.857 5.50e-119 334.0
Bial13g01829 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.786 7.84e-166 457.0
Bial13g01799 BST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 69.643 6.86e-49 149.0
Bial13g01733 BST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 91.824 1.59e-96 275.0
Bial13g01651 BST,WGDA 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.5 2.27e-93 265.0
Bial13g00107 . 1 167 Cytoplasmic Ribosomal Protein gene family AT1G67430 93.413 6.30e-119 331.0
Bial13g00041 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Bial7g03770 ACH 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 84.314 1.38e-112 318.0
Bial7g03728 ACH,BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 63.478 2.72e-43 142.0
Bial7g03716 ACH,BST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 1.48e-71 207.0
Bial7g03670 ACH,BST,WGDA 4 155 Cytoplasmic Ribosomal Protein gene family AT2G36620 83.66 2.14e-77 236.0
Bial7g03669 ACH,BST,WGDA 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 85.714 1.10e-85 246.0
Bial7g03642 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 89.899 4.67e-60 178.0
Bial7g03630 ACH,BST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 80.128 3.96e-81 236.0
Bial24g00444 ACH,BST,WGDA 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 87.662 1.42e-86 249.0
Bial4g01783 ACH,BST 1 287 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.003 9.52e-163 454.0
Bial4g01702 ACH,BST 164 227 Cytoplasmic Ribosomal Protein gene family AT5G10360 72.727 5.43e-21 84.0
Bial4g01672 ACH,BST 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.923 1.81e-91 263.0
Bial4g01628 ACH,BST,WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Bial4g00886 BST 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 81.89 5.32e-60 180.0
Bial4g00893 BST 1 136 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.765 1.00e-86 249.0
Bial4g00897 ACH,BST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.286 1.71e-125 351.0
Bial4g03054 . 86 133 Cytoplasmic Ribosomal Protein gene family AT5G63070 43.75 3.38e-10 52.0
Bial4g03256 BST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 91.549 1.55e-41 133.0
Bial4g03257 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.49e-46 156.0
Bial4g03408 ACH,BST,WGDA 10 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 42.384 1.83e-34 116.0
Bial4g03571 . 1 131 Cytoplasmic Ribosomal Protein gene family AT1G43170 92.366 1.05e-77 236.0
Bial4g00715 ACH,BST 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.333 2.99e-126 351.0
Bial4g00576 BST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 1.09e-120 336.0
Bial4g00459 BST,WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Bial4g00295 BST 26 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 30.822 2.44e-06 45.1
Bial4g00252 BST 1 149 Cytoplasmic Ribosomal Protein gene family AT4G00100 93.289 2.57e-97 285.0
Bial4g00124 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 53.521 1.42e-11 59.7
Bial4g00121 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 52.113 6.39e-11 57.8
Bial4g00118 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 52.113 6.39e-11 57.8
Bial4g00115 BST 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 52.113 6.16e-11 58.2
Bial4g00107 BST 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 52.113 6.30e-11 57.8
Bial8g00038 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Bial13g02263 ACH,BST,WGDA 36 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 42.308 1.24e-31 111.0
Bial13g00798 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 2.29e-83 242.0
Bial13g01072 ACH,BST,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT5G60670 87.952 1.00e-105 298.0
Bial13g01127 ACH,BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.421 3.40e-34 112.0
Bial13g01156 ACH,BST,WGDA 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.864 1.07e-125 353.0
Bial13g01196 BST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 1.11e-101 288.0
Bial19g03406 ACH,BST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 3.34e-71 207.0
Bial19g03475 . 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 86.282 8.93e-178 493.0
Bial19g03476 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 78.616 6.76e-179 495.0
Bial23g01872 . 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.132 7.45e-83 238.0
Bial23g02001 . 9 211 Cytoplasmic Ribosomal Protein gene family AT2G27530 25.238 6.65e-07 48.1
Bial20g02236 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.77 9.35e-171 469.0
Bial18g03436 . 64 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 30.693 2.19e-09 52.4
Bial18g03437 BST,WGDA 64 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 30.693 2.91e-09 52.4
Bial10g03384 BST 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Bial10g03483 BST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 1.78e-08 50.8
Bial6g03114 . 49 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 36.709 2.98e-07 43.9
Bial6g03106 BST,WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 1.85e-06 42.4
Bial6g03096 BST,WGDA 30 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 38.384 1.66e-09 52.0
Bial12g02159 ACH 42 122 Cytoplasmic Ribosomal Protein gene family AT2G16360 86.42 4.13e-48 147.0
Bial12g02051 BST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 5.03e-81 233.0
Bial12g01764 WGDA 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 56.4 5.02e-89 261.0
Bial12g01687 BST,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.857 2.71e-115 335.0
Bial4g01067 ACH,BST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Bial4g01058 ACH,BST 96 131 Cytoplasmic Ribosomal Protein gene family AT3G04920 77.778 7.82e-11 56.6
Bial4g01047 . 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 47.015 3.40e-25 89.7
Bial4g00984 ACH,BST 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.762 2.83e-126 353.0
Bial4g00980 ACH,BST 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 88.172 8.19e-123 342.0
Bial4g00972 . 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 81.89 1.77e-60 180.0
Bial24g01525 ACH 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 82.192 3.97e-89 254.0
Bial1g01133 . 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 80.537 2.13e-80 232.0
Bial1g01110 ACH,WGDA 3 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.714 8.70e-95 268.0
Bial6g03333 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.931 0.0 497.0
Bial1g00911 ACH,BST,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT5G60670 87.952 1.00e-105 298.0
Bial1g00968 ACH,BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.421 3.40e-34 112.0
Bial1g00993 BST,WGDA 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 1.64e-125 352.0
Bial1g01042 BST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 1.07e-100 287.0
Bial6g02587 BST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.679 1.21e-96 274.0
Bial6g02692 BST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 73.913 4.31e-30 102.0
Bial8g00862 BST 5 108 Cytoplasmic Ribosomal Protein gene family AT2G40010 41.346 1.34e-21 86.3
Bial8g00861 . 56 108 Cytoplasmic Ribosomal Protein gene family AT2G40010 43.396 3.07e-09 51.2
Bial8g00834 BST 5 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 91.111 3.59e-90 259.0
Bial8g00833 BST 52 139 Cytoplasmic Ribosomal Protein gene family AT3G11510 94.318 7.28e-58 173.0
Bial11g02731 WGDA 1 243 Cytoplasmic Ribosomal Protein gene family AT1G80750 56.504 7.67e-85 259.0
Bial11g02728 ACH,BST 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 4.69e-64 191.0
Bial11g02693 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 40.541 2.16e-06 45.4
Bial19g03689 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 63.478 4.56e-45 140.0
Bial19g03678 ACH,BST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 1.42e-71 207.0
Bial19g03634 ACH,BST,WGDA 3 155 Cytoplasmic Ribosomal Protein gene family AT2G36620 82.468 3.28e-79 236.0
Bial19g03633 ACH,BST,WGDA 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 85.065 1.48e-84 244.0
Bial19g03596 ACH,BST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 80.769 3.03e-82 239.0
Bial22g00067 . 1 64 Cytoplasmic Ribosomal Protein gene family AT5G64140 92.308 5.74e-37 116.0
Bial22g00084 ACH,WGDA 2 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.767 5.18e-130 363.0
Bial1g00528 ACH,BST 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 1.26e-72 213.0
Bial1g00671 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 88.235 6.09e-126 352.0
Bial22g00269 BST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 89.815 5.63e-55 164.0
Bial13g00743 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 88.235 1.75e-125 350.0
Bial13g00615 ACH,BST 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 1.26e-72 213.0
Bial20g02273 BST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.833 8.88e-76 218.0
Bial9g00454 . 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 8.60e-59 174.0
Bial13g01325 . 26 136 Cytoplasmic Ribosomal Protein gene family AT3G04400 33.913 7.38e-14 67.0
Bial13g01297 . 54 164 Cytoplasmic Ribosomal Protein gene family AT2G37190 46.957 1.54e-21 82.0
Bial13g01285 ACH 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 7.25e-96 272.0
Bial13g01261 ACH 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 79.866 2.23e-79 229.0
Bial11g02244 . 9 211 Cytoplasmic Ribosomal Protein gene family AT2G27530 25.238 5.56e-07 48.1
Bial15g03528 ACH,BST,WGDA 38 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 30.0 4.55e-08 47.4
Bial15g03474 . 64 109 Cytoplasmic Ribosomal Protein gene family AT5G45775 72.917 2.15e-18 76.3
Bial12g03486 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 81.579 3.18e-115 329.0
Bial12g03549 . 1 292 Cytoplasmic Ribosomal Protein gene family AT5G39740 79.452 3.24e-177 494.0
Bial13g03095 ACH,BST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Bial1g02889 ACH,BST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Bial24g02071 BST,WGDA 1 387 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.664 0.0 719.0
Bial24g02131 BST,WGDA 76 129 Cytoplasmic Ribosomal Protein gene family AT5G09490 40.741 1.52e-08 49.3
Bial24g02406 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.247 7.76e-90 256.0
Bial24g02459 BST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.835 1.91e-138 384.0
Bial24g02538 BST,WGDA 36 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 86.458 1.40e-54 164.0
Bial24g02543 ACH,BST,WGDA 16 139 Cytoplasmic Ribosomal Protein gene family AT3G04400 99.194 9.16e-88 253.0
Bial24g02552 BST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Bial24g02581 ACH,BST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.434 2.21e-125 351.0
Bial24g02585 BST,WGDA 32 178 Cytoplasmic Ribosomal Protein gene family AT5G27850 84.354 2.59e-88 261.0
Bial24g02633 BST,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.545 1.19e-123 348.0
Bial24g02648 BST,WGDA 8 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 82.609 2.89e-38 121.0
Bial24g02957 ACH,BST,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 87.952 2.35e-106 299.0
Bial22g01754 BST 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 80.851 3.53e-122 345.0
Bial22g01880 BST 99 216 Cytoplasmic Ribosomal Protein gene family AT3G51190 40.678 1.04e-22 90.1
Bial22g02275 ACH,BST,WGDA 1 73 Cytoplasmic Ribosomal Protein gene family AT3G44590 60.274 3.69e-23 84.3
Bial22g02276 . 18 70 Cytoplasmic Ribosomal Protein gene family AT3G44590 60.0 1.11e-12 62.4
Bial22g02288 ACH,BST,WGDA 1 200 Cytoplasmic Ribosomal Protein gene family AT1G08360 90.5 1.08e-119 336.0
Bial22g02349 BST,WGDA 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 80.69 2.05e-79 229.0
Bial22g02384 BST 1 67 Cytoplasmic Ribosomal Protein gene family AT3G52590 55.882 9.75e-14 65.5
Bial22g02617 BST 2 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.298 6.60e-57 169.0
Bial22g02635 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.34e-50 156.0
Bial22g02689 BST,WGDA 1 181 Cytoplasmic Ribosomal Protein gene family AT4G10450 81.215 2.48e-110 313.0
Bial22g02894 BST 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 100.0 3.72e-50 155.0
Bial22g03031 BST 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.40e-126 353.0
Bial22g03125 BST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 3.28e-08 50.1
Bial22g03320 BST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.77 3.36e-119 335.0
Bial22g03323 . 1 129 Cytoplasmic Ribosomal Protein gene family AT4G29430 72.868 1.42e-72 211.0
Bial2g03338 . 1 171 Cytoplasmic Ribosomal Protein gene family AT1G67430 87.845 6.75e-118 329.0
Bial2g03302 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.053 2.97e-108 303.0
Bial2g03221 . 131 186 Cytoplasmic Ribosomal Protein gene family AT5G15200 57.143 3.72e-16 68.2
Bial2g03205 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Bial2g02373 . 47 95 Cytoplasmic Ribosomal Protein gene family AT1G52300 85.714 1.24e-26 92.0
Bial11g02613 BST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 77.083 6.81e-110 310.0
Bial11g02527 BST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 85.315 2.35e-91 259.0
Bial11g02468 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.381 2.96e-168 463.0
Bial10g03284 BST 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 100.0 3.72e-50 155.0
Bial10g03085 BST 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.889 1.30e-09 55.1
Bial10g03074 BST 1 181 Cytoplasmic Ribosomal Protein gene family AT4G10450 81.215 2.48e-110 313.0
Bial10g03073 WGDA 1 192 Cytoplasmic Ribosomal Protein gene family AT1G33140 81.771 7.19e-117 328.0
Bial10g03024 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.58e-47 157.0
Bial10g03003 BST 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 8.11e-58 171.0
Bial10g02746 BST 1 67 Cytoplasmic Ribosomal Protein gene family AT3G52590 55.882 9.75e-14 65.5
Bial10g02742 . 1 67 Cytoplasmic Ribosomal Protein gene family AT3G52590 51.471 1.41e-11 56.6
Bial10g02712 BST,WGDA 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 80.69 2.05e-79 229.0
Bial10g02650 ACH,BST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.815 4.18e-131 366.0
Bial10g02638 BST 18 70 Cytoplasmic Ribosomal Protein gene family AT3G44590 60.0 7.13e-14 66.6
Bial10g02637 ACH,BST,WGDA 1 73 Cytoplasmic Ribosomal Protein gene family AT3G44590 60.274 3.69e-23 84.3
Bial9g01734 . 181 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 75.362 1.53e-27 98.6
Bial9g01854 . 74 107 Cytoplasmic Ribosomal Protein gene family AT1G74270 73.529 1.08e-09 53.1
Bial9g01981 ACH,BST,WGDA 2 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 94.413 3.94e-127 353.0
Bial9g02013 BST,WGDA 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 82.524 9.23e-109 310.0
Bial9g02051 . 55 131 Cytoplasmic Ribosomal Protein gene family AT3G04400 30.0 2.33e-08 48.9
Bial9g02072 BST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 93.377 1.48e-101 286.0
Bial9g02100 BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.87 2.94e-39 125.0
Bial9g02184 BST 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 3.77e-58 173.0
Bial9g02372 BST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.636 2.21e-120 335.0
Bial9g02554 BST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 36.486 5.20e-06 44.3
Bial9g02651 . 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Bial9g02653 . 27 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.553 1.47e-58 174.0
Bial9g02655 . 53 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 88.235 4.72e-37 119.0
Bial9g02657 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.833 5.02e-76 219.0
Bial3g04011 ACH,BST,WGDA 38 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 30.0 4.55e-08 47.4
Bial1g02199 BST,WGDA 23 121 Cytoplasmic Ribosomal Protein gene family AT5G62300 30.0 2.86e-07 45.8
Bial1g02215 ACH,BST,WGDA 3 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 84.39 7.41e-123 351.0
Bial1g02602 BST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 92.754 5.00e-43 131.0
Bial17g01169 . 31 73 Cytoplasmic Ribosomal Protein gene family AT3G44590 79.545 2.65e-14 64.3
Bial17g01115 ACH,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 2.01e-64 192.0
Bial17g00867 BST 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.5 2.27e-93 265.0
Bial17g00835 ACH,BST 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 3.25e-145 407.0
Bial17g00826 ACH,BST,WGDA 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 90.244 5.43e-79 230.0
Bial17g00485 ACH,BST,WGDA 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.727 2.22e-145 402.0
Bial17g00422 ACH,BST,WGDA 30 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 89.423 6.06e-70 203.0
Bial17g00333 ACH,BST,WGDA 16 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 99.2 1.52e-88 251.0
Bial17g00227 ACH,BST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 94.737 1.48e-106 299.0
Bial17g00225 ACH,BST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.806 1.47e-84 242.0
Bial17g00117 ACH,BST,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 84.127 2.64e-62 184.0
Bial17g00073 ACH,BST,WGDA 37 197 Cytoplasmic Ribosomal Protein gene family AT3G16780 85.714 4.51e-97 277.0
Bial21g00698 ACH,BST,WGDA 36 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 85.859 4.72e-56 168.0
Bial21g00728 ACH,BST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 87.864 1.38e-136 379.0
Bial21g00752 ACH,BST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 5.93e-84 240.0
Bial21g00760 ACH,BST,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 84.167 9.17e-71 209.0
Bial21g00898 . 2 47 Cytoplasmic Ribosomal Protein gene family AT3G61110 67.391 9.88e-15 64.7
Bial21g00931 ACH,BST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 86.076 4.33e-146 409.0
Bial21g00936 ACH,BST,WGDA 1 121 Cytoplasmic Ribosomal Protein gene family AT3G47370 90.083 1.92e-72 223.0
Bial21g00965 BST,WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 9.91e-92 260.0
Bial21g00992 ACH,BST,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.154 5.10e-91 257.0
Bial21g01222 BST,WGDA 36 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 82.101 1.57e-158 441.0
Bial21g01380 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.313 0.0 498.0
Bial21g01394 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.023 8.69e-162 450.0
Bial21g01506 BST,WGDA 183 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 71.642 3.72e-25 91.3
Bial21g01697 . 137 231 Cytoplasmic Ribosomal Protein gene family AT4G34670 61.053 4.58e-30 107.0
Bial14g00784 BST,WGDA 53 387 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.552 0.0 620.0
Bial14g00640 BST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Bial14g00494 BST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 89.308 2.91e-95 270.0
Bial14g00437 BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.932 5.34e-91 259.0
Bial14g00401 BST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 91.667 5.68e-56 167.0
Bial14g00375 BST,WGDA 2 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 76.812 1.60e-70 212.0
Bial14g00369 BST,WGDA 1 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 66.393 9.67e-112 317.0
Bial19g01408 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 83.444 2.77e-85 244.0
Bial19g01775 ACH,BST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.815 4.92e-130 363.0
Bial19g01787 ACH,BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 66.372 1.36e-28 108.0
Bial19g01969 ACH,BST,WGDA 3 124 Cytoplasmic Ribosomal Protein gene family AT5G02960 94.262 8.89e-80 246.0
Bial19g02064 ACH,BST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Bial19g02099 ACH,BST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 77.778 1.76e-77 224.0
Bial19g02156 ACH,BST,WGDA 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 1.31e-90 258.0
Bial19g02235 . 48 105 Cytoplasmic Ribosomal Protein gene family AT2G39390 81.034 6.08e-25 97.1
Bial19g02241 ACH,BST,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 4.03e-72 211.0
Bial19g02461 ACH,BST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.962 9.38e-126 352.0
Bial19g02528 ACH,BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.168 7.16e-178 488.0
Bial19g02608 ACH,BST,WGDA 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 81.746 1.13e-150 422.0
Bial19g02669 ACH,BST,WGDA 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 89.431 4.62e-79 227.0
Bial19g02736 . 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.923 5.33e-92 261.0
Bial10g02283 BST 99 216 Cytoplasmic Ribosomal Protein gene family AT3G51190 40.678 1.04e-22 90.1
Bial10g02170 ACH,BST 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.545 3.19e-124 350.0
Bial10g01789 ACH,BST 1 126 Cytoplasmic Ribosomal Protein gene family AT5G59850 95.238 8.58e-88 253.0
Bial10g01667 BST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 77.876 1.64e-60 180.0
Bial10g01641 ACH,BST 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.727 8.25e-146 404.0
Bial10g01616 BST,WGDA 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 80.479 0.0 501.0
Bial10g01583 ACH,BST 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 2.17e-83 238.0
Bial10g01543 ACH,BST 1 159 Cytoplasmic Ribosomal Protein gene family AT5G48760 86.792 5.82e-105 298.0
Bial10g01506 ACH,BST,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Bial10g01494 WGDA 1 82 Cytoplasmic Ribosomal Protein gene family AT4G27090 70.732 1.71e-33 110.0
Bial10g01406 ACH,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 94.737 5.59e-107 300.0
Bial10g01404 ACH 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.06 2.00e-84 243.0
Bial10g01308 ACH,WGDA 32 186 Cytoplasmic Ribosomal Protein gene family AT3G05590 85.161 2.13e-98 279.0
Bial10g01298 ACH,BST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.256 3.17e-126 353.0
Bial10g00942 ACH,BST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 84.416 8.92e-84 242.0
Bial10g00893 ACH,BST 2 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 88.67 2.45e-121 353.0
Bial10g00773 ACH,BST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.071 3.76e-71 219.0
Bial10g00711 ACH,BST,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 1.96e-72 212.0
Bial10g00704 ACH,BST 48 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 90.667 3.15e-42 132.0
Bial24g03043 BST,WGDA 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 78.523 1.91e-78 227.0
Bial24g03026 ACH,BST,WGDA 17 206 Cytoplasmic Ribosomal Protein gene family AT3G11940 83.684 6.39e-122 342.0
Bial24g03010 ACH,BST,WGDA 5 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.151 8.72e-120 353.0
Bial24g03005 ACH,BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 69.027 5.74e-33 109.0
Bial20g00744 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 89.815 4.42e-55 165.0
Bial20g00786 ACH 1 123 Cytoplasmic Ribosomal Protein gene family AT4G15000 72.358 3.31e-63 187.0
Bial22g01005 ACH,BST 36 116 Cytoplasmic Ribosomal Protein gene family AT4G27090 83.951 4.75e-41 139.0
Bial22g01018 ACH,BST 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Bial22g01061 ACH,BST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 84.951 1.03e-133 372.0
Bial22g01099 ACH,BST 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.962 8.17e-83 237.0
Bial22g01131 BST,WGDA 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 80.479 0.0 501.0
Bial22g01161 ACH,BST 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.727 8.69e-146 404.0
Bial22g01186 BST,WGDA 33 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 72.84 3.65e-37 120.0
Bial5g00300 ACH,BST,WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G44590 74.286 2.58e-30 104.0
Bial5g00336 ACH,BST 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 1.71e-125 351.0
Bial5g00358 BST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 70.122 1.64e-74 218.0
Bial5g00446 BST 1 80 Cytoplasmic Ribosomal Protein gene family AT3G52590 32.5 7.06e-06 42.7
Bial5g00700 ACH,BST,WGDA 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 5.47e-145 401.0
Bial5g00765 ACH,BST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.211 2.94e-83 238.0
Bial5g00866 ACH,BST,WGDA 16 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 99.2 1.52e-88 251.0
Bial5g00965 ACH,BST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 75.658 4.90e-76 220.0
Bial5g00967 ACH,BST,WGDA 48 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.535 1.66e-53 161.0
Bial5g01067 ACH,BST,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 85.6 1.99e-61 182.0
Bial5g01111 ACH,BST,WGDA 1 197 Cytoplasmic Ribosomal Protein gene family AT3G16780 86.802 1.85e-125 351.0
Bial5g01235 . 83 130 Cytoplasmic Ribosomal Protein gene family AT5G48760 77.083 3.56e-20 78.2
Bial5g01290 ACH,BST,WGDA 103 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 66.667 1.61e-13 65.1
Bial5g01450 . 34 90 Cytoplasmic Ribosomal Protein gene family AT5G15520 43.86 2.08e-06 43.1
Bial5g01494 ACH,BST 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 82.716 1.30e-48 147.0
Bial5g01500 ACH,BST,WGDA 7 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 77.57 5.75e-55 179.0
Bial5g01832 . 176 241 Cytoplasmic Ribosomal Protein gene family AT5G10360 83.333 4.99e-30 105.0
Bial5g01905 BST,WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 30.0 1.02e-06 46.2
Bial5g01998 WGDA 1 237 Cytoplasmic Ribosomal Protein gene family AT2G31610 87.029 5.88e-150 420.0
Bial5g02230 BST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 82.589 2.21e-133 374.0
Bial5g02752 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.641 1.46e-162 449.0
Bial5g02924 ACH,BST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.889 3.07e-10 57.0
Bial7g00994 . 1 78 Cytoplasmic Ribosomal Protein gene family AT3G52590 97.436 1.89e-46 159.0
Bial7g01140 BST 1 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 81.034 0.0 673.0
Bial7g01151 ACH,BST 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 5.32e-166 457.0
Bial7g01152 BST 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 83.133 5.20e-147 408.0
Bial7g01191 ACH,BST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT4G34555 91.304 1.74e-37 134.0
Bial7g01298 ACH,BST,WGDA 3 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.714 1.14e-92 281.0
Bial7g01478 ACH,BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 66.372 1.54e-28 108.0
Bial7g01489 ACH,BST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 2.16e-129 362.0
Bial7g01840 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 83.444 2.77e-85 244.0
Bial7g01958 ACH,BST,WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.429 8.04e-08 49.7
Bial7g02099 ACH,BST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT4G15000 79.646 5.18e-63 191.0
Bial7g02161 ACH,BST,WGDA 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 1.31e-90 258.0
Bial7g02247 ACH,BST,WGDA 27 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 90.625 1.82e-72 212.0
Bial7g02456 . 71 186 Cytoplasmic Ribosomal Protein gene family AT3G05590 86.207 1.67e-73 214.0
Bial7g02472 ACH,BST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.962 1.09e-125 352.0
Bial7g02524 ACH,BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.313 0.0 500.0
Bial7g02598 ACH,BST,WGDA 7 254 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.731 2.00e-150 421.0
Bial7g02648 ACH,BST,WGDA 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 89.431 4.62e-79 227.0
Bial7g02707 ACH,BST,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.774 7.68e-85 252.0
Bial7g02911 ACH,BST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.16 1.09e-170 471.0
Bial8g02668 BST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.833 8.88e-76 218.0
Bial8g02669 BST 54 91 Cytoplasmic Ribosomal Protein gene family AT1G26880 86.842 4.07e-17 72.4
Bial8g02752 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 86.986 2.28e-90 268.0
Bial8g02886 ACH,BST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 5.09e-65 192.0
Bial8g02954 ACH,BST,WGDA 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 90.31 1.48e-177 487.0
Bial8g03021 ACH,BST,WGDA 2 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.294 1.04e-122 354.0
Bial4g02454 BST 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 85.185 2.60e-50 150.0
Bial4g02557 BST 1 390 Cytoplasmic Ribosomal Protein gene family AT1G61580 86.154 0.0 695.0
Bial4g02558 . 236 264 Cytoplasmic Ribosomal Protein gene family AT1G43170 82.759 9.49e-11 54.7
Bial4g02784 . 176 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 77.027 2.55e-28 100.0
Bial4g02895 . 1 57 Cytoplasmic Ribosomal Protein gene family AT3G52590 33.333 2.97e-06 44.7
Bial16g02064 BST 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 85.185 2.60e-50 150.0
Bial16g02175 BST 53 387 Cytoplasmic Ribosomal Protein gene family AT1G43170 87.463 0.0 605.0
Bial16g02176 . 237 264 Cytoplasmic Ribosomal Protein gene family AT1G43170 92.857 1.42e-12 58.5
Bial14g00982 BST,WGDA 56 143 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.182 2.47e-58 175.0
Bial14g01021 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 87.671 4.33e-92 261.0
Bial14g01103 BST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.833 3.61e-76 219.0
Bial14g01161 ACH,BST,WGDA 16 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 76.364 9.04e-157 435.0
Bial14g01443 . 149 227 Cytoplasmic Ribosomal Protein gene family AT5G10360 64.557 1.73e-21 85.1
Bial14g01678 BST,WGDA 5 77 Cytoplasmic Ribosomal Protein gene family AT3G62250 31.507 2.15e-06 45.8
Bial14g01773 BST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.518 5.51e-152 421.0
Bial14g01875 BST,WGDA 1 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 87.079 5.07e-116 330.0
Bial14g02065 BST,WGDA 96 251 Cytoplasmic Ribosomal Protein gene family AT2G41840 29.091 9.21e-15 71.2
Bial23g00314 BST 1 119 Cytoplasmic Ribosomal Protein gene family AT4G09800 80.672 1.09e-64 191.0
Bial23g00312 BST 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 2.75e-85 243.0
Bial23g00731 BST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.963 8.14e-113 318.0
Bial17g01313 ACH,BST 10 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.333 1.74e-43 133.0
Bial17g01575 . 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.44 1.10e-111 315.0
Bial17g01735 ACH,BST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 81.675 1.54e-113 322.0
Bial17g01817 BST 2 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 89.362 2.97e-53 179.0
Bial17g02500 ACH 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Bial17g02599 BST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 7.08e-101 286.0
Bial17g02621 ACH,BST 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 1.71e-125 351.0
Bial17g02656 ACH,BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 66.667 2.35e-33 110.0
Bial23g02296 . 1 120 Cytoplasmic Ribosomal Protein gene family AT5G61170 87.5 1.51e-78 226.0
Bial24g01907 BST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 5.03e-81 233.0
Bial14g03064 . 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 81.746 4.67e-151 423.0
Bial14g03121 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.931 0.0 496.0
Bial20g02374 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 86.986 1.49e-91 267.0
Bial21g02310 BST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 89.205 7.96e-121 337.0
Bial21g02144 BST 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 3.86e-58 174.0
Bial21g02057 BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.87 1.17e-38 124.0
Bial21g02035 BST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 93.377 3.35e-101 286.0
Bial21g01984 BST,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.545 3.31e-124 350.0
Bial21g01958 ACH,BST,WGDA 2 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.855 1.75e-126 352.0
Bial15g02566 ACH,BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.26 8.44e-163 451.0
Bial15g02738 ACH,BST 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Bial15g03105 ACH,BST 1 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 91.824 4.97e-97 275.0
Bial15g03199 ACH,BST,WGDA 6 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 85.816 2.74e-90 257.0
Bial22g01707 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 82.833 2.72e-116 355.0
Bial22g01306 ACH 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.923 3.62e-92 260.0
Bial9g00720 ACH,BST,WGDA 36 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 85.859 2.18e-55 169.0
Bial9g00744 ACH,BST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 72.33 1.37e-101 289.0
Bial9g00770 ACH,BST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 2.17e-83 238.0
Bial9g00778 ACH,BST,WGDA 25 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 83.158 1.58e-55 166.0
Bial9g00940 ACH,BST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 3.83e-145 406.0
Bial9g00944 ACH 1 121 Cytoplasmic Ribosomal Protein gene family AT3G47370 90.083 1.39e-77 223.0
Bial9g00974 BST,WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 87.5 5.21e-75 216.0
Bial9g01005 ACH,BST,WGDA 1 127 Cytoplasmic Ribosomal Protein gene family AT5G59850 92.126 1.59e-79 242.0
Bial9g01211 BST,WGDA 3 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 82.069 0.0 500.0
Bial9g01357 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.313 0.0 498.0
Bial9g01372 . 35 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 80.702 1.03e-132 372.0
Bial9g01373 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.023 6.37e-164 452.0
Bial9g01505 BST,WGDA 183 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 71.642 3.72e-25 91.3
Bial15g02118 ACH,BST,WGDA 2 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 82.632 1.42e-109 326.0
Bial15g02117 . 153 200 Cytoplasmic Ribosomal Protein gene family AT3G49010 70.833 2.23e-12 57.4
Bial15g02115 ACH,BST,WGDA 36 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 73.077 1.37e-77 228.0
Bial15g01799 WGDA 22 119 Cytoplasmic Ribosomal Protein gene family AT3G47370 31.313 8.08e-08 47.4
Bial15g01782 ACH,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.784 1.22e-127 358.0
Bial15g01713 ACH 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 92.248 0.0 496.0
Bial15g01088 BST 25 190 Cytoplasmic Ribosomal Protein gene family AT2G40010 23.256 6.62e-08 50.4
Bial11g02140 ACH 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 79.47 2.97e-82 237.0
Bial16g01577 ACH,BST 1 287 Cytoplasmic Ribosomal Protein gene family AT2G40010 76.307 1.37e-162 454.0
Bial16g01495 ACH,BST 164 227 Cytoplasmic Ribosomal Protein gene family AT5G10360 72.727 5.43e-21 84.0
Bial16g01494 . 164 227 Cytoplasmic Ribosomal Protein gene family AT5G10360 72.727 6.93e-22 84.0
Bial16g01468 ACH 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.923 3.62e-92 260.0
Bial16g01425 ACH,BST 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Bial20g01548 . 164 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 68.182 1.08e-28 102.0
Bial20g01411 ACH 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 2.49e-87 251.0
Bial20g01281 BST 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 1.40e-125 351.0
Bial20g02556 ACH,BST,WGDA 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 90.698 3.87e-178 488.0
Bial20g02628 ACH,BST,WGDA 3 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.222 2.43e-121 352.0
Bial18g01048 BST,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 66.953 2.13e-93 270.0
Bial18g00958 BST,WGDA 33 140 Cytoplasmic Ribosomal Protein gene family AT4G00100 96.296 1.64e-72 211.0
Bial18g00869 BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 59.483 4.65e-40 127.0
Bial18g00849 BST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Bial18g00810 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 58.621 2.54e-38 123.0
Bial18g00737 BST,WGDA 43 107 Cytoplasmic Ribosomal Protein gene family AT5G02450 89.231 1.55e-31 108.0
Bial18g00531 BST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 87.5 3.18e-119 333.0
Bial18g00155 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 1.27e-77 223.0
Bial18g00055 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.053 2.97e-108 303.0
Bial18g00019 . 1 171 Cytoplasmic Ribosomal Protein gene family AT1G67430 92.982 2.89e-121 337.0
Bial24g01102 BST,WGDA 46 154 Cytoplasmic Ribosomal Protein gene family AT2G39460 43.363 8.45e-21 82.8
Bial1g01634 BST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.786 7.84e-166 457.0
Bial1g01608 BST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 69.643 6.86e-49 149.0
Bial1g01541 BST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 91.824 2.66e-97 276.0
Bial1g01453 BST,WGDA 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.5 2.27e-93 265.0
Bial1g01313 ACH,BST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.5 1.15e-08 52.8
Bial15g01537 ACH,BST 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 83.817 1.02e-153 430.0
Bial7g03490 . 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 85.921 1.27e-172 491.0
Bial7g03489 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.987 1.33e-178 494.0
Bial7g03486 ACH 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 92.857 9.73e-76 217.0
Bial7g03433 ACH,BST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 3.34e-71 207.0
Bial7g03327 ACH,BST,WGDA 53 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 70.051 6.02e-88 255.0
Bial7g03165 ACH,BST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 60.656 1.54e-48 150.0
Bial7g03057 ACH,WGDA 2 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 78.571 1.93e-60 180.0
Bial12g00185 . 164 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 70.455 2.86e-30 109.0
Bial21g00023 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.844 5.55e-79 244.0
Bial21g00033 . 5 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 82.5 4.46e-59 177.0
Bial21g00044 . 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.559 1.73e-120 339.0
Bial21g00148 ACH,BST,WGDA 23 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 42.0 2.63e-06 45.1
Bial16g02802 ACH,BST,WGDA 1 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 41.615 8.20e-35 117.0
Bial16g02778 . 42 66 Cytoplasmic Ribosomal Protein gene family AT5G24510 68.0 1.52e-06 42.7
Bial16g02697 . 56 100 Cytoplasmic Ribosomal Protein gene family AT3G53020 86.667 1.15e-20 78.6
Bial16g02692 . 2 119 Cytoplasmic Ribosomal Protein gene family AT3G53020 90.678 7.59e-75 222.0
Bial14g03040 . 49 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.381 3.72e-123 350.0
Bial14g02850 BST,WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 2.85e-06 42.4
Bial14g02840 . 24 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 36.19 2.02e-09 50.4
Bial14g02838 . 30 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 37.374 5.11e-09 50.4
Bial14g02836 BST,WGDA 55 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 36.986 1.31e-06 42.4
Bial14g02559 . 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.132 7.45e-83 238.0
Bial14g02433 BST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 75.362 5.25e-31 105.0
Bial14g02332 BST,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT3G48930 92.254 9.01e-86 249.0
Bial20g00040 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Bial3g01610 ACH,BST 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 84.232 3.67e-153 424.0
Bial1g02020 ACH,BST,WGDA 135 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 64.912 7.96e-21 79.7
Bial16g00051 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 2.28e-45 157.0
Bial16g00109 BST 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 52.113 2.95e-11 58.9
Bial16g00119 BST 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 53.521 1.52e-11 59.3
Bial16g00230 BST 1 148 Cytoplasmic Ribosomal Protein gene family AT4G00100 74.324 2.00e-70 215.0
Bial16g00267 BST 84 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 41.176 1.12e-06 45.1
Bial16g00429 BST,WGDA 1 121 Cytoplasmic Ribosomal Protein gene family AT3G52590 97.521 1.45e-86 246.0
Bial14g02205 ACH,BST,WGDA 4 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 45.833 2.65e-10 57.4
Bial14g02239 BST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 89.286 1.26e-70 210.0
Bial5g03225 BST,WGDA 64 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 30.693 2.11e-09 52.8
Bial12g03217 BST,WGDA 1 137 Cytoplasmic Ribosomal Protein gene family AT5G04800 83.453 4.81e-78 232.0
Bial12g03201 ACH,BST,WGDA 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 83.77 7.33e-123 344.0
Bial12g03185 ACH,BST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.815 4.92e-130 363.0
Bial12g03180 ACH,BST,WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G44590 72.857 1.89e-30 103.0
Bial12g03131 ACH,BST,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 87.952 9.31e-106 300.0
Bial20g00615 BST 5 107 Cytoplasmic Ribosomal Protein gene family AT2G40010 40.777 9.67e-21 84.0
Bial20g00585 BST 52 139 Cytoplasmic Ribosomal Protein gene family AT3G11510 94.318 7.28e-58 173.0
Bial20g00584 BST 5 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 91.111 2.21e-90 258.0
Bial20g00988 ACH,BST 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 88.961 3.04e-76 222.0
Bial19g02890 ACH,BST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.16 9.98e-171 470.0
Bial10g00085 ACH,BST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 78.947 3.23e-81 234.0
Bial10g00319 ACH,BST,WGDA 2 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.767 5.18e-130 363.0
Bial10g00323 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 69.027 7.23e-33 110.0
Bial10g00362 ACH 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 86.145 8.89e-105 295.0
Bial23g00840 BST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 36.486 3.01e-08 50.4
Bial23g01001 . 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Bial16g00683 ACH,BST 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Bial16g00828 ACH,BST,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 81.89 1.77e-60 180.0
Bial16g00835 ACH,BST 1 136 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.765 1.00e-86 249.0
Bial16g00839 ACH,BST 1 200 Cytoplasmic Ribosomal Protein gene family AT3G16780 66.667 3.26e-86 249.0
Bial16g00887 . 48 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.372 2.09e-53 160.0
Bial16g00889 ACH,WGDA 48 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.372 2.09e-53 160.0
Bial16g00892 ACH,BST,WGDA 33 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 82.178 8.20e-54 170.0
Bial16g00896 ACH,BST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Bial16g01054 ACH,BST 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 74.272 7.27e-105 297.0
Bial16g01116 ACH,WGDA 27 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 79.57 2.19e-51 155.0
Bial16g01145 ACH 44 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 26.852 2.15e-07 45.4
Bial3g00113 ACH,BST 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 85.0 2.25e-71 207.0
Bial23g02484 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 40.541 2.16e-06 45.4
Bial23g02513 . 23 79 Cytoplasmic Ribosomal Protein gene family AT2G32060 66.667 8.59e-24 86.3
Bial23g02517 . 170 242 Cytoplasmic Ribosomal Protein gene family AT2G44120 54.795 5.58e-25 93.6
Bial20g02777 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 5.32e-166 457.0
Bial20g02769 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.889 9.70e-07 48.1
Bial1g00079 . 2 40 Cytoplasmic Ribosomal Protein gene family AT2G45710 84.615 4.94e-16 71.2
Bial23g02363 . 7 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 79.459 3.10e-110 311.0
Bial22g00892 ACH,BST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.256 3.17e-126 353.0
Bial13g02645 BST,WGDA 13 126 Cytoplasmic Ribosomal Protein gene family AT3G07110 30.303 1.15e-06 45.8
Bial24g03504 BST 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 91.803 2.15e-79 227.0
Bial24g03427 . 1 126 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.032 2.33e-85 252.0
Bial24g03337 WGDA 1 110 Cytoplasmic Ribosomal Protein gene family AT3G56340 78.182 1.03e-59 178.0
Bial24g03322 WGDA 1 292 Cytoplasmic Ribosomal Protein gene family AT5G39740 79.452 1.69e-178 494.0
Bial16g02658 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.44e-47 157.0
Bial16g02657 BST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 91.549 2.32e-41 132.0
Bial21g00512 . 15 128 Cytoplasmic Ribosomal Protein gene family AT4G18730 28.226 1.11e-06 46.2
Bial21g00370 BST 13 104 Cytoplasmic Ribosomal Protein gene family AT5G24510 55.789 2.68e-26 95.1
Bial24g01415 BST,WGDA 4 120 Cytoplasmic Ribosomal Protein gene family AT5G61170 88.889 2.11e-76 222.0
Bial24g01467 ACH,BST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 79.581 6.80e-114 320.0
Bial19g01095 BST 1 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 80.788 0.0 673.0
Bial19g01109 BST 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 5.32e-166 457.0
Bial19g01110 BST 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 83.133 5.20e-147 408.0
Bial19g01290 ACH,BST,WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.429 6.58e-08 49.7
Bial14g00954 ACH,BST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 5.14e-65 192.0
Bial14g00913 ACH,BST,WGDA 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 79.457 1.13e-147 410.0
Bial10g00503 ACH,BST,WGDA 3 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.0 1.58e-91 284.0
Bial10g00609 ACH,BST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 89.815 5.63e-55 164.0
Bial14g00093 . 42 139 Cytoplasmic Ribosomal Protein gene family AT2G44860 69.388 1.46e-45 143.0
Bial20g02514 ACH,BST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 5.09e-65 192.0
Bial11g01828 WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT3G02080 81.119 1.51e-83 256.0
Bial11g01254 . 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Bial11g01126 BST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 36.486 3.60e-08 50.1
Bial11g00975 BST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.963 4.15e-113 318.0
Bial11g00937 . 176 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 77.027 4.53e-28 100.0
Bial11g00489 BST 1 119 Cytoplasmic Ribosomal Protein gene family AT4G09800 80.672 1.09e-64 191.0
Bial11g00487 BST 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 2.75e-85 243.0
Bial6g00726 BST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Bial6g00742 BST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 57.391 2.68e-38 124.0
Bial6g00832 BST,WGDA 33 140 Cytoplasmic Ribosomal Protein gene family AT4G00100 96.296 1.64e-72 211.0
Bial6g00923 ACH,BST,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 83.691 2.89e-128 360.0
Bial6g00999 ACH,WGDA 79 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 96.078 1.36e-71 209.0
Bial6g01178 ACH,BST,WGDA 1 74 Cytoplasmic Ribosomal Protein gene family AT3G62250 40.0 1.19e-10 58.9
Bial6g01718 WGDA 164 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 67.045 1.70e-28 104.0
Bial6g01722 . 164 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 67.045 1.70e-28 104.0
Bial6g01939 BST,WGDA 5 77 Cytoplasmic Ribosomal Protein gene family AT3G62250 31.507 2.43e-06 45.8
Bial6g01951 . 102 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 82.353 4.60e-68 202.0
Bial6g02003 BST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.518 5.51e-152 421.0
Bial6g02108 BST,WGDA 44 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 89.63 2.28e-89 260.0
Bial6g02309 BST,WGDA 96 251 Cytoplasmic Ribosomal Protein gene family AT2G41840 29.091 9.03e-15 71.2
Bial6g02437 ACH,BST,WGDA 4 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 45.833 2.62e-10 57.4
Bial6g02476 BST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 89.286 1.00e-70 210.0