AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Bial22g00887 ATGGCCGCCGATGCATACAATCCTACTTCCTTTCCGATTCTCTGTAATGCCGCTGCTGGTGCTTCCGCTGGAGTTATTGCAGCTACATTTGTGTGTCCTTTAGATGTGATCAAAACCAGGTTTCAGGTTCATGGACTTCCGCAGCTTAACGGTGGAGTTGTGAGAGGTAGTCTTATAATAGGTAGCTTAGAACACATTTTTCGCAAGGAAGGGGCGCGCGGTTTGTACCGTGGGCTTTCGCCCACTATTCTTGCCTTGCTTCCAAACTGGGCGGTGAGTTGTGTTTATTTTACTATATACGAGCAGCTCAAAGGTTTGCTCGGCTCTGATGGAATTCATGGCCTATCTTTCGGTGCCAACATGTTAGCTGCTTCAGGAGCCGGAGCTGCAACAACCATTGTGACAAATCCTTTATGGGTTGTGAAGACACGGCTACAAACTCAAGGTATGAGGGCAGGCCTAATGCCATATAGGGGTACACTTTCAGCTTTGAGAAAAATTGCTCATGAAGAGGGTATTCGTGGCTTATACAGTGGTCTAGTACCTGCATTAGTTGGCATTAGTCATGTTGCAATTCAATTTCCAGCGTATGAGAAGATCAAACTCTATTTGGCTAGTAGAGATGGTACCACAACTGATCAACTTGGTGCTCGTGACGTTGCTGTTGCTTCTTCAGTTTCAAAAATATTTGCATCCACATTAACGTATCCACACGAGGTTGTTAGGTCAAGGCTTCAAGAACAAGGGCACCATTCTGAAAAGAGATACGCGGGAATGATGGACTGCATAAGGAAAGTATTTGAAAAAGAAGGGTTTCGTGGGTTTTATCGTGGTTGTGCTACAAACTTATTGAGGACAACCCCTGCTGCGGTTATAACGTTTACAAGCTTTGAAATGATTCACCGGTTTCTTGTCACTTTATTCCCTTCTGACCCTAATCCTCACACATTATCAAGATAA 960 44.48 MAADAYNPTSFPILCNAAAGASAGVIAATFVCPLDVIKTRFQVHGLPQLNGGVVRGSLIIGSLEHIFRKEGARGLYRGLSPTILALLPNWAVSCVYFTIYEQLKGLLGSDGIHGLSFGANMLAASGAGAATTIVTNPLWVVKTRLQTQGMRAGLMPYRGTLSALRKIAHEEGIRGLYSGLVPALVGISHVAIQFPAYEKIKLYLASRDGTTTDQLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYAGMMDCIRKVFEKEGFRGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPSDPNPHTLSR 319
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Bial22g00887 319 ProSiteProfiles Solute carrier (Solcar) repeat profile. 215 303 IPR018108 -
Bial22g00887 319 ProSiteProfiles Solute carrier (Solcar) repeat profile. 11 106 IPR018108 -
Bial22g00887 319 Pfam Mitochondrial carrier protein 115 205 IPR018108 -
Bial22g00887 319 Pfam Mitochondrial carrier protein 221 305 IPR018108 -
Bial22g00887 319 Pfam Mitochondrial carrier protein 12 109 IPR018108 -
Bial22g00887 319 FunFam NAD+ transporter 113 308 - -
Bial22g00887 319 Gene3D Mitochondrial carrier domain 12 304 IPR023395 -
Bial22g00887 319 PRINTS Mitochondrial carrier protein signature 224 246 IPR002067 GO:0055085(InterPro)
Bial22g00887 319 PRINTS Mitochondrial carrier protein signature 29 43 IPR002067 GO:0055085(InterPro)
Bial22g00887 319 PRINTS Mitochondrial carrier protein signature 16 29 IPR002067 GO:0055085(InterPro)
Bial22g00887 319 PRINTS Mitochondrial carrier protein signature 130 148 IPR002067 GO:0055085(InterPro)
Bial22g00887 319 FunFam Nicotinamide adenine dinucleotide transporter 1, chloroplastic 3 112 - -
Bial22g00887 319 SUPERFAMILY Mitochondrial carrier 11 299 IPR023395 -
Bial22g00887 319 ProSiteProfiles Solute carrier (Solcar) repeat profile. 115 203 IPR018108 -
Bial22g00887 319 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 13 308 IPR044712 GO:0006862(InterPro)|GO:0022857(PANTHER)|GO:0035352(PANTHER)|GO:0051724(PANTHER)|GO:0055085(InterPro)|GO:0055085(PANTHER)
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Bial22g00887 K15115 solute carrier family 25 (mitochondrial folate transporter), member 32
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
182233 Bial10g01293 Bial22g00887
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
679196 Bial Bial13g00300 Bial-Chr13:3411601 Bial22g00887 Bial-Chr22:8483856
696873 Bial Bial19g01353 Bial-Chr19:46901132 Bial22g00887 Bial-Chr22:8483856
699189 Bial Bial1g00237 Bial-Chr1:2534710 Bial22g00887 Bial-Chr22:8483856
707303 Bial Bial22g00887 Bial-Chr22:8483856 Bial8g00494 Bial-Chr8:5924492
782175 Bial Bial10g01293 Bial-Chr10:12887611 Bial22g00887 Bial-Chr22:8483856
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Bial12g01302 . 1 280 Chloroplast and Mitochondria gene family AT4G10340 80.277 3.49e-151 425.0
Bial4g01339 . 51 254 Chloroplast and Mitochondria gene family AT3G61470 66.176 2.19e-99 293.0
Bial12g00477 . 36 300 Chloroplast and Mitochondria gene family AT4G25700 72.963 2.92e-142 401.0
Bial14g00248 BST,WGDA 5 183 Chloroplast and Mitochondria gene family AT1G17530 61.202 1.13e-69 209.0
Bial14g00110 BST,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.513 2.51e-160 450.0
Bial18g02954 BST,WGDA 143 354 Chloroplast and Mitochondria gene family AT2G28800 20.179 4.82e-06 47.0
Bial18g02413 . 33 252 Chloroplast and Mitochondria gene family AT3G61470 91.818 5.57e-150 419.0
Bial2g00379 ACH,BST,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.513 2.16e-160 450.0
Bial2g00523 ACH,BST,WGDA 5 183 Chloroplast and Mitochondria gene family AT1G17530 61.202 4.38e-69 207.0
Bial2g00838 ACH,BST,WGDA 153 253 Chloroplast and Mitochondria gene family AT1G15820 77.228 5.29e-52 164.0
Bial2g01083 BST,WGDA 9 316 Chloroplast and Mitochondria gene family AT1G07030 30.696 1.02e-34 127.0
Bial2g01265 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.65e-121 346.0
Bial2g01266 . 46 265 Chloroplast and Mitochondria gene family AT2G05100 74.888 2.14e-117 333.0
Bial2g01683 BST,WGDA 3 373 Chloroplast and Mitochondria gene family AT5G14040 77.089 0.0 575.0
Bial8g01774 BST 87 271 Chloroplast and Mitochondria gene family AT4G03320 40.0 4.14e-42 142.0
Bial12g00835 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.691 0.0 509.0
Bial24g00256 . 14 107 Chloroplast and Mitochondria gene family AT3G08940 69.474 2.06e-43 139.0
Bial24g00257 . 148 287 Chloroplast and Mitochondria gene family AT5G01530 82.143 2.49e-75 223.0
Bial4g01938 . 70 548 Chloroplast and Mitochondria gene family AT2G18710 84.342 0.0 820.0
Bial3g03553 ACH,BST,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.143 8.01e-165 462.0
Bial3g03402 ACH,BST,WGDA 9 187 Chloroplast and Mitochondria gene family AT1G17530 63.128 1.04e-72 216.0
Bial3g03080 ACH 1 71 Chloroplast and Mitochondria gene family AT5G05370 67.606 3.78e-34 110.0
Bial3g03051 ACH,BST 1 57 Chloroplast and Mitochondria gene family AT5G05370 70.175 1.82e-27 93.2
Bial24g00798 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.016 0.0 512.0
Bial9g00405 . 4 580 Chloroplast and Mitochondria gene family AT4G21490 66.265 0.0 793.0
Bial3g02823 ACH,BST,WGDA 1 258 Chloroplast and Mitochondria gene family AT1G15820 83.721 2.29e-152 423.0
Bial8g01013 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.917 1.35e-141 403.0
Bial8g00089 . 79 404 Chloroplast and Mitochondria gene family AT2G28800 64.368 1.67e-154 447.0
Bial8g00494 WGDA 7 319 Chloroplast and Mitochondria gene family AT1G25380 44.937 1.58e-70 219.0
Bial8g00676 BST 4 131 Chloroplast and Mitochondria gene family AT4G25570 47.656 1.88e-39 130.0
Bial8g00677 BST 1 223 Chloroplast and Mitochondria gene family AT1G14730 61.435 5.68e-94 273.0
Bial22g00437 BST 37 321 Chloroplast and Mitochondria gene family AT1G25380 24.843 7.41e-28 109.0
Bial6g00413 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 9.50e-171 470.0
Bial12g03598 BST 52 447 Chloroplast and Mitochondria gene family AT2G28800 77.078 0.0 601.0
Bial12g02385 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.5 2.79e-167 462.0
Bial13g01471 . 33 214 Chloroplast and Mitochondria gene family AT1G07030 29.891 9.61e-20 88.6
Bial4g03437 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 87.546 2.72e-170 469.0
Bial4g00486 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 69.202 1.32e-120 341.0
Bial4g00485 . 2 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 6.01e-168 463.0
Bial4g00483 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.821 1.26e-169 467.0
Bial23g02048 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 82.918 3.57e-151 422.0
Bial23g02049 . 109 280 Chloroplast and Mitochondria gene family AT4G10340 86.047 8.18e-98 282.0
Bial23g02153 . 51 254 Chloroplast and Mitochondria gene family AT3G61470 48.309 5.66e-60 189.0
Bial18g03467 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 66.228 1.76e-111 318.0
Bial10g03451 BST 3 143 Chloroplast and Mitochondria gene family AT1G07020 44.366 4.36e-24 89.4
Bial12g01809 BST,WGDA 26 307 Chloroplast and Mitochondria gene family AT5G40810 86.219 6.28e-173 479.0
Bial23g01367 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.691 0.0 506.0
Bial6g03381 . 1 190 Chloroplast and Mitochondria gene family AT3G08940 70.769 1.60e-90 263.0
Bial1g00481 ACH,BST 37 318 Chloroplast and Mitochondria gene family AT1G07030 31.69 5.54e-32 120.0
Bial22g00075 . 2 369 Chloroplast and Mitochondria gene family AT5G14040 76.63 0.0 574.0
Bial1g00510 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 85.417 2.21e-144 402.0
Bial7g04073 . 26 292 Chloroplast and Mitochondria gene family AT2G17270 59.48 1.32e-112 323.0
Bial20g02475 ACH,BST 1 367 Chloroplast and Mitochondria gene family AT5G14040 70.845 0.0 537.0
Bial13g00594 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 85.417 2.21e-144 402.0
Bial20g02264 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.224 2.88e-75 227.0
Bial20g02265 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.224 1.19e-74 226.0
Bial23g00092 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 63.9 1.18e-105 303.0
Bial11g02285 . 109 280 Chloroplast and Mitochondria gene family AT4G10340 86.047 8.18e-98 282.0
Bial11g02284 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 82.918 3.57e-151 422.0
Bial9g00502 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.892 2.54e-151 421.0
Bial13g00300 BST,WGDA 33 327 Chloroplast and Mitochondria gene family AT1G25380 66.113 1.08e-140 401.0
Bial1g02730 ACH,BST,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 64.431 5.18e-148 419.0
Bial24g02242 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.5 2.64e-167 462.0
Bial22g02812 BST 192 300 Chloroplast and Mitochondria gene family AT1G25380 24.59 3.20e-06 43.9
Bial22g03098 BST 3 143 Chloroplast and Mitochondria gene family AT1G07020 43.662 1.74e-23 87.8
Bial2g02961 . 22 224 Chloroplast and Mitochondria gene family AT5G38630 41.379 5.64e-53 168.0
Bial11g02558 . 35 255 Chloroplast and Mitochondria gene family AT3G61470 50.679 1.80e-73 223.0
Bial11g02320 . 38 254 Chloroplast and Mitochondria gene family AT3G61470 38.636 4.42e-52 170.0
Bial9g02373 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.821 1.03e-167 462.0
Bial17g01161 ACH,BST 1 364 Chloroplast and Mitochondria gene family AT5G14040 73.901 0.0 544.0
Bial19g01546 ACH,BST,WGDA 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.544 3.30e-114 324.0
Bial19g01720 ACH,BST,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.161 0.0 509.0
Bial19g02550 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.942 2.32e-165 458.0
Bial10g02066 . 6 266 Chloroplast and Mitochondria gene family AT2G34430 86.973 1.22e-166 459.0
Bial10g02065 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 3.53e-171 471.0
Bial10g02019 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 82.482 7.14e-159 442.0
Bial10g01786 BST,WGDA 51 449 Chloroplast and Mitochondria gene family AT2G28800 68.719 1.11e-179 508.0
Bial10g01681 BST 1 329 Chloroplast and Mitochondria gene family AT2G30160 70.181 6.96e-167 466.0
Bial10g01293 BST 1 307 Chloroplast and Mitochondria gene family AT2G47490 75.563 6.98e-162 452.0
Bial10g01278 BST 56 306 Chloroplast and Mitochondria gene family AT1G25380 23.507 1.17e-07 53.9
Bial10g00794 BST 37 321 Chloroplast and Mitochondria gene family AT1G25380 24.375 3.41e-28 110.0
Bial16g01812 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 65.278 4.47e-34 109.0
Bial16g01800 . 68 346 Chloroplast and Mitochondria gene family AT1G72820 51.254 4.79e-83 249.0
Bial22g01200 BST 1 329 Chloroplast and Mitochondria gene family AT2G30160 70.181 1.08e-166 465.0
Bial5g01340 ACH,BST 1 356 Chloroplast and Mitochondria gene family AT5G14040 73.315 0.0 526.0
Bial5g02306 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.991 3.84e-150 418.0
Bial5g02792 BST,WGDA 143 354 Chloroplast and Mitochondria gene family AT2G28800 20.179 4.82e-06 47.0
Bial7g01127 BST,WGDA 33 322 Chloroplast and Mitochondria gene family AT1G25380 28.75 6.85e-14 70.9
Bial7g01537 ACH,BST,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.839 0.0 504.0
Bial7g01707 ACH,BST,WGDA 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.544 5.96e-114 323.0
Bial7g01893 ACH,BST,WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.429 6.00e-47 158.0
Bial7g02545 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.942 2.32e-165 458.0
Bial8g02657 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.224 2.42e-75 228.0
Bial8g02658 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.224 1.44e-74 226.0
Bial8g02840 ACH,BST 1 367 Chloroplast and Mitochondria gene family AT5G14040 61.905 0.0 518.0
Bial8g02939 . 61 354 Chloroplast and Mitochondria gene family AT5G54290 78.571 2.14e-145 414.0
Bial14g01312 . 3 108 Chloroplast and Mitochondria gene family AT5G14040 51.887 1.46e-25 97.1
Bial14g01313 BST,WGDA 3 373 Chloroplast and Mitochondria gene family AT5G14040 76.28 0.0 569.0
Bial14g01672 BST,WGDA 26 292 Chloroplast and Mitochondria gene family AT2G17270 62.172 4.83e-120 343.0
Bial14g01851 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 2.34e-170 469.0
Bial14g01852 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 4.36e-172 474.0
Bial23g02326 . 35 255 Chloroplast and Mitochondria gene family AT3G61470 51.131 4.32e-74 224.0
Bial24g01675 BST,WGDA 26 270 Chloroplast and Mitochondria gene family AT3G27240 54.183 2.06e-75 231.0
Bial14g03168 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 85.348 6.19e-163 462.0
Bial21g02443 . 4 216 Chloroplast and Mitochondria gene family AT4G25570 42.723 3.60e-58 182.0
Bial21g02311 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.448 2.18e-167 462.0
Bial15g03051 ACH,BST,WGDA 1 258 Chloroplast and Mitochondria gene family AT1G15820 83.721 6.29e-153 424.0
Bial15g03277 ACH,BST 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 8.91e-35 111.0
Bial19g00039 . 103 327 Chloroplast and Mitochondria gene family AT1G76570 71.111 4.89e-115 328.0
Bial22g01608 . 6 266 Chloroplast and Mitochondria gene family AT2G34430 87.356 5.87e-167 460.0
Bial22g01607 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 8.77e-171 470.0
Bial22g01550 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 82.847 1.74e-159 444.0
Bial22g01303 BST,WGDA 51 449 Chloroplast and Mitochondria gene family AT2G28800 77.586 0.0 608.0
Bial16g01168 ACH,WGDA 51 252 Chloroplast and Mitochondria gene family AT3G61470 56.931 5.11e-77 238.0
Bial20g01643 BST 118 271 Chloroplast and Mitochondria gene family AT4G03320 40.506 2.08e-37 127.0
Bial20g02545 BST 61 354 Chloroplast and Mitochondria gene family AT5G54290 56.818 3.05e-87 266.0
Bial18g00529 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 9.50e-171 470.0
Bial18g00362 . 149 220 Chloroplast and Mitochondria gene family AT1G14730 40.278 2.69e-13 62.0
Bial15g01579 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.057 1.50e-179 492.0
Bial15g01578 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.057 6.65e-180 493.0
Bial12g00190 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 64.234 1.49e-106 307.0
Bial16g02831 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 81.319 1.45e-152 424.0
Bial3g01650 . 50 265 Chloroplast and Mitochondria gene family AT2G05070 93.519 2.00e-151 419.0
Bial3g01649 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.057 6.65e-180 493.0
Bial16g00455 . 83 266 Chloroplast and Mitochondria gene family AT2G34430 85.326 3.52e-111 316.0
Bial16g00459 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.567 5.87e-170 468.0
Bial20g00419 BST 1 223 Chloroplast and Mitochondria gene family AT1G14730 61.435 4.87e-94 273.0
Bial20g00418 BST 4 131 Chloroplast and Mitochondria gene family AT4G25570 48.438 1.25e-39 131.0
Bial10g00008 . 4 306 Chloroplast and Mitochondria gene family AT2G17270 62.379 1.13e-146 413.0
Bial10g00043 ACH,BST,WGDA 33 308 Chloroplast and Mitochondria gene family AT1G25380 36.842 2.01e-48 164.0
Bial10g00310 ACH 2 369 Chloroplast and Mitochondria gene family AT5G14040 66.146 1.39e-173 485.0
Bial23g00828 BST 128 236 Chloroplast and Mitochondria gene family AT1G26100 61.468 1.46e-33 114.0
Bial23g02707 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 70.115 1.28e-174 486.0
Bial22g00887 BST 1 307 Chloroplast and Mitochondria gene family AT2G47490 75.563 6.98e-162 452.0
Bial22g00870 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.625 1.10e-29 115.0
Bial24g03421 BST,WGDA 52 447 Chloroplast and Mitochondria gene family AT2G28800 64.987 1.29e-165 471.0
Bial7g00033 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 79.93 7.68e-176 488.0
Bial24g01233 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 81.851 2.67e-153 427.0
Bial11g00093 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 64.167 7.70e-102 311.0
Bial19g01081 BST 33 322 Chloroplast and Mitochondria gene family AT1G25380 28.75 9.29e-14 70.5
Bial19g01353 ACH,BST,WGDA 29 210 Chloroplast and Mitochondria gene family AT2G47490 37.297 2.14e-28 107.0
Bial14g00922 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 4.90e-122 347.0
Bial14g00921 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.543 9.24e-122 346.0
Bial1g00237 BST,WGDA 200 327 Chloroplast and Mitochondria gene family AT1G25380 57.252 5.87e-51 166.0
Bial13g02946 ACH,BST,WGDA 6 343 Chloroplast and Mitochondria gene family AT1G72820 63.905 1.10e-144 410.0
Bial11g01862 . 1 263 Chloroplast and Mitochondria gene family AT5G15640 70.342 3.94e-138 391.0
Bial11g01861 . 1 320 Chloroplast and Mitochondria gene family AT5G15640 72.5 1.37e-177 492.0
Bial11g01633 ACH,BST,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.016 0.0 506.0
Bial11g01137 BST 10 236 Chloroplast and Mitochondria gene family AT1G26100 65.546 3.57e-95 277.0
Bial6g01931 ACH,BST,WGDA 1 297 Chloroplast and Mitochondria gene family AT2G17270 69.667 1.98e-161 450.0
Bial6g02085 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 87.833 1.19e-167 462.0
Bial6g02086 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 5.74e-172 473.0