AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cati3g00594 AGCAACCCCAAAGAATTGAAACCCAAAAGTAATCTTGATCTCATGGCAACTCAAGCATTGGTTTCATCTTCATCACTCACCTCCTCAGTGGATCTCCCAGGTGATTTTGGATTTGACCCACTCGGCCTCTCAGACCCAGAAGGCACTGGAGGCTTCATCGAACCCAGGTGGCTAGCCTACGGAGAAGTCATCAATGGACGTTTCGCCATGTTAGGCGCAGCCGGAGCCATCGCACCCGAGATCTTTGGCAAACTCGGGCTCATCCCACCCGAGACCGCCCTCCCATGGTTCCAGACCGGTGTCATCCCACCCGCCGGCACCTACAACTACTGGGCCGACCCTTACACCCTATTCGTTATGGAAATGGCCTTCATGGGCTTCGCGGAGCACCGAAGGTTCCAAGATTGGTACAACCCAGGGTCAATGGGGAAACAATACTTCTTGGGCCTAGAAAAGGGCTTTTCCGGGTCGGGTGACCCCGCGTACCCAGGTGGGCCGTTTTTTAACCCATTGGGGTTCGGGAAGGATGAGAAGTCAATGAAAGAGTTGAAGTTGAAGGAGATTAAGAATGGTAGATTGGCTATGTTGGCTATTTTGGGTTACTTCATTCAGGGTCTGGTGACTGGGGTAGGACCTTTCCAGAACCTTCTGGACCATTTGGCTGACCCGGTCAACAACAATGTTTTGACCAGCCTTAAGTTCCACTAGATCACTGTCTGCTTTACTTCCTATTATATGTGCAGAATTTCGACGAGATATTTATTATTATTAATTTGTAACAAAATCAGTGGTATGTTAAGGAAACTGAAACCTTGTTGCTACTCTATCCATATGGTCATTGGTTGTGTAGATTCATAGATTCAATATTTCCAATTGCAGTTACCAAAAGTTGCATGAAATCAAATTCCCAAAAATA 916 47.38 SNPKELKPKSNLDLMATQALVSSSSLTSSVDLPGDFGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAAGAIAPEIFGKLGLIPPETALPWFQTGVIPPAGTYNYWADPYTLFVMEMAFMGFAEHRRFQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 235
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Cati3g00594 235 Gene3D Chlorophyll a-b binding protein domain 15 234 - -
Cati3g00594 235 Pfam Chlorophyll A-B binding protein 31 205 IPR022796 -
Cati3g00594 235 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 23 230 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Cati3g00594 235 FunFam Chlorophyll a-b binding protein, chloroplastic 16 234 - -
Cati3g00594 235 SUPERFAMILY Chlorophyll a-b binding protein 31 231 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cati3g00594 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Cati Cati-Chr3:6169141 Cati9g02287 Cati-Chr9:26721799 dispersed
Cati Cati-Chr3:6169141 Cati7g03155 Cati-Chr7:68110709 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cati10g00004 . 12 253 Chloroplast and Mitochondria gene family AT2G47490 29.01 5.71e-19 85.1
Cati10g00123 . 3 143 Chloroplast and Mitochondria gene family AT1G07020 50.704 3.48e-29 102.0
Cati10g00646 . 51 448 Chloroplast and Mitochondria gene family AT2G28800 63.682 1.30e-164 469.0
Cati10g00822 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 70.122 1.97e-164 459.0
Cati10g00880 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 3.13e-32 104.0
Cati10g01325 . 4 302 Chloroplast and Mitochondria gene family AT2G47490 66.862 1.71e-148 419.0
Cati10g01326 . 4 302 Chloroplast and Mitochondria gene family AT2G47490 75.497 3.34e-156 437.0
Cati10g02039 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 85.766 6.59e-166 460.0
Cati10g02041 . 166 287 Chloroplast and Mitochondria gene family AT5G01530 88.525 1.77e-73 220.0
Cati10g02042 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 86.496 7.27e-166 460.0
Cati10g02959 . 17 300 Chloroplast and Mitochondria gene family AT4G25700 55.663 4.68e-109 316.0
Cati10g02958 . 17 300 Chloroplast and Mitochondria gene family AT4G25700 55.663 4.68e-109 316.0
Cati11g00003 ACH 21 307 Chloroplast and Mitochondria gene family AT5G40810 87.241 1.86e-178 493.0
Cati11g00655 . 52 216 Chloroplast and Mitochondria gene family AT5G15640 43.03 6.47e-37 128.0
Cati11g00656 . 14 316 Chloroplast and Mitochondria gene family AT5G15640 50.658 8.91e-101 297.0
Cati11g00658 . 54 314 Chloroplast and Mitochondria gene family AT5G15640 56.322 3.93e-100 294.0
Cati11g00657 . 54 314 Chloroplast and Mitochondria gene family AT5G15640 51.724 1.07e-89 266.0
Cati11g00660 . 7 313 Chloroplast and Mitochondria gene family AT5G15640 63.192 1.82e-133 378.0
Cati11g00659 . 7 313 Chloroplast and Mitochondria gene family AT5G15640 63.192 1.82e-133 378.0
Cati11g03104 . 17 316 Chloroplast and Mitochondria gene family AT1G07030 29.801 9.31e-33 127.0
Cati12g01348 ACH 1 57 Chloroplast and Mitochondria gene family AT5G05370 71.93 3.84e-26 89.7
Cati12g01924 . 46 548 Chloroplast and Mitochondria gene family AT2G18710 80.0 0.0 804.0
Cati12g02559 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 68.599 4.29e-103 300.0
Cati1g00298 . 65 132 Chloroplast and Mitochondria gene family AT5G38630 66.176 1.97e-25 98.6
Cati1g00299 . 65 132 Chloroplast and Mitochondria gene family AT5G38630 66.176 1.85e-27 99.0
Cati1g00687 ACH 29 294 Chloroplast and Mitochondria gene family AT2G47490 30.994 1.61e-33 125.0
Cati1g02179 . 1 165 Chloroplast and Mitochondria gene family AT1G29930 63.03 7.03e-61 186.0
Cati1g02180 . 167 250 Chloroplast and Mitochondria gene family AT2G34430 79.762 1.23e-39 131.0
Cati1g02185 . 2 267 Chloroplast and Mitochondria gene family AT1G29930 86.466 2.44e-170 469.0
Cati2g00308 . 143 345 Chloroplast and Mitochondria gene family AT2G28800 21.596 4.23e-07 50.4
Cati2g00307 . 143 345 Chloroplast and Mitochondria gene family AT2G28800 21.596 4.23e-07 50.4
Cati2g01024 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 79.372 5.88e-126 355.0
Cati2g01619 . 1 287 Chloroplast and Mitochondria gene family AT2G17270 63.415 2.16e-131 376.0
Cati2g01620 . 1 292 Chloroplast and Mitochondria gene family AT2G17270 57.534 3.75e-119 341.0
Cati2g02120 . 10 321 Chloroplast and Mitochondria gene family AT1G25380 56.369 1.09e-109 320.0
Cati2g02247 . 10 236 Chloroplast and Mitochondria gene family AT1G26100 65.823 1.38e-90 265.0
Cati2g02703 . 197 260 Chloroplast and Mitochondria gene family AT5G15640 43.75 1.41e-07 44.3
Cati2g02704 . 17 182 Chloroplast and Mitochondria gene family AT5G15640 47.904 3.78e-44 146.0
Cati3g00338 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.791 1.34e-121 346.0
Cati3g00592 . 18 70 Chloroplast and Mitochondria gene family AT1G61520 60.377 8.07e-10 53.9
Cati3g00594 . 58 273 Chloroplast and Mitochondria gene family AT1G61520 88.889 2.96e-141 394.0
Cati3g01846 . 1 70 Chloroplast and Mitochondria gene family AT5G40810 50.685 4.29e-15 68.9
Cati4g00332 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 76.119 4.20e-141 394.0
Cati4g02862 . 5 213 Chloroplast and Mitochondria gene family AT4G25570 31.579 1.61e-22 89.7
Cati4g02863 ACH 4 218 Chloroplast and Mitochondria gene family AT4G25570 42.326 1.24e-53 174.0
Cati5g00641 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.429 7.50e-169 472.0
Cati5g01016 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.923 1.47e-150 419.0
Cati5g01451 . 178 228 Chloroplast and Mitochondria gene family AT2G05100 78.431 1.60e-22 85.5
Cati5g02117 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 73.234 1.56e-128 367.0
Cati6g01998 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 3.49e-170 469.0
Cati6g01999 . 18 267 Chloroplast and Mitochondria gene family AT1G29930 86.8 8.08e-158 447.0
Cati6g02000 . 1 264 Chloroplast and Mitochondria gene family AT1G29930 86.742 3.65e-167 462.0
Cati6g02001 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 3.21e-162 467.0
Cati6g02002 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 7.24e-170 468.0
Cati6g02003 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 5.88e-171 473.0
Cati6g03744 ACH 2 366 Chloroplast and Mitochondria gene family AT5G14040 71.507 0.0 509.0
Cati7g00087 . 76 407 Chloroplast and Mitochondria gene family AT2G28800 61.473 1.32e-149 435.0
Cati7g00634 . 96 175 Chloroplast and Mitochondria gene family AT1G25380 54.217 1.13e-12 62.0
Cati7g00824 ACH 150 224 Chloroplast and Mitochondria gene family AT1G14730 48.0 1.40e-16 71.2
Cati7g00825 ACH 1 223 Chloroplast and Mitochondria gene family AT1G14730 58.296 2.66e-89 261.0
Cati7g01400 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 85.892 1.12e-144 402.0
Cati7g01402 ACH 95 239 Chloroplast and Mitochondria gene family AT3G54890 93.103 6.69e-98 280.0
Cati7g01401 . 1 105 Chloroplast and Mitochondria gene family AT3G54890 73.394 6.29e-41 134.0
Cati7g02399 . 46 275 Chloroplast and Mitochondria gene family AT4G03320 37.395 2.48e-47 158.0
Cati7g02572 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.62 4.02e-149 415.0
Cati7g03105 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 90.566 0.0 501.0
Cati7g03155 . 19 273 Chloroplast and Mitochondria gene family AT1G61520 88.627 2.82e-170 469.0
Cati8g00162 . 1 215 Chloroplast and Mitochondria gene family AT4G25570 60.465 2.00e-90 264.0
Cati8g00609 . 37 321 Chloroplast and Mitochondria gene family AT1G25380 25.0 1.34e-29 114.0
Cati8g00938 ACH 1 239 Chloroplast and Mitochondria gene family AT3G54890 51.667 1.48e-69 210.0
Cati8g01738 . 2 368 Chloroplast and Mitochondria gene family AT5G14040 77.717 0.0 575.0
Cati8g01812 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 79.88 1.53e-180 499.0
Cati8g02434 ACH 29 294 Chloroplast and Mitochondria gene family AT2G47490 37.591 6.02e-47 159.0
Cati8g02576 . 5 309 Chloroplast and Mitochondria gene family AT2G17270 65.472 7.89e-152 426.0
Cati8g05050 . 27 327 Chloroplast and Mitochondria gene family AT1G76570 78.073 0.0 501.0
Cati8g05051 . 32 325 Chloroplast and Mitochondria gene family AT1G76570 55.405 3.72e-104 304.0
Cati9g00138 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 71.268 1.03e-180 503.0
Cati9g00531 . 1 228 Chloroplast and Mitochondria gene family AT5G14040 64.912 4.65e-100 293.0
Cati9g00897 . 55 250 Chloroplast and Mitochondria gene family AT3G61470 55.612 1.27e-71 218.0
Cati9g01352 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 80.287 3.31e-142 410.0
Cati9g01353 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 73.404 9.18e-126 358.0
Cati9g01354 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 81.004 9.55e-148 413.0
Cati9g01446 . 41 324 Chloroplast and Mitochondria gene family AT1G07030 32.867 2.87e-33 123.0
Cati9g01832 ACH 1 370 Chloroplast and Mitochondria gene family AT5G14040 71.429 0.0 540.0
Cati9g01939 . 18 354 Chloroplast and Mitochondria gene family AT5G54290 53.254 1.65e-85 258.0
Cati9g01938 . 18 354 Chloroplast and Mitochondria gene family AT5G54290 53.254 1.65e-85 258.0
Cati9g01941 . 18 354 Chloroplast and Mitochondria gene family AT5G54290 53.254 1.65e-85 258.0
Cati9g01940 . 18 354 Chloroplast and Mitochondria gene family AT5G54290 53.254 1.65e-85 258.0
Cati9g01942 . 18 314 Chloroplast and Mitochondria gene family AT5G54290 50.336 8.28e-68 212.0
Cati9g01946 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.48e-122 349.0
Cati9g02287 . 32 255 Chloroplast and Mitochondria gene family AT3G61470 53.571 2.05e-77 233.0