AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Ccar2g01972 GGTGACTCAACACCAACCACAACCTCAATCCCACCAGGCCCACAACCTTTGCCCTTATGTTTCCTCCTCCCTTTCCCTCATGGTGGCACTGCAACCCCAAATCTTTTCAAGAAACCCAAGATCTTGATCATGGCAACTCAAGCTTTGGTCTCATCTTCATCACTCACCTCCTCAGTGGAGTCTGCTAGACAAATCTTTGGAGCAAGGCCTGTTCAGTCCCCTTCAAGAAAGCTCTCCTTTCTTGTCAAAGCTGCTTCCACTCCTCCTGTTAAGCAAGGAGCTAACAGACAACTGTGGTTTGCATCCAAGCAGTCTCTCTCTTACTTGGATGGGAGTCTCCCAGGTGACTTTGGATTCGACCCACTTGGTCTCTCAGACCCAGAAGGCACCGGAGGGTTCATCGAACCCAGGTGGCTAGCTTACGGAGAGGTTATCAATGGACGGTTCGCCATGTTGGGTGCAGCTGGAGCCATTGCACCAGAGATTTTCGGCAAACTTGGGCTCATCCCAGCTGAGACCGCCCTCCCCTGGTTCCAGACCGGTGTCATTCCCCCAGCCGGCACTTATAACTACTGGGCTGACCCTTACACCCTATTCGTCATGGAAATGGCATTCATGGGTTTTGCAGAGCACAGAAGGTTCCAAGATTGGTACAACCCAGGTTCAATGGGGAAACAATACTTCTTGGGGTTAGAGAAGGGGTTTTCCGGGTCGGGTGATCCAGCATACCCGGGTGGGCCGTTTTTCAACCCATTAGGGTTTGGGAAAGATGAGAAATCAATGAAGGAATTGAAGCTAAAGGAGATCAAGAATGGTAGATTGGCTATGTTAGCCATCTTGGGTTACTTCATTCAAGGTCTGGTGACTGGGGTTGGACCTTTCCAGAACCTTCTGGACCATTTGGCTGACCCTGTCAACAACAATGTCTTGACCAGCCTTAAGTTCCACTAG 951 50.37 GDSTPTTTSIPPGPQPLPLCFLLPFPHGGTATPNLFKKPKILIMATQALVSSSSLTSSVESARQIFGARPVQSPSRKLSFLVKAASTPPVKQGANRQLWFASKQSLSYLDGSLPGDFGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAAGAIAPEIFGKLGLIPAETALPWFQTGVIPPAGTYNYWADPYTLFVMEMAFMGFAEHRRFQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 316
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Ccar2g01972 316 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 49 311 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Ccar2g01972 316 FunFam Chlorophyll a-b binding protein, chloroplastic 97 315 - -
Ccar2g01972 316 Pfam Chlorophyll A-B binding protein 107 286 IPR022796 -
Ccar2g01972 316 SUPERFAMILY Chlorophyll a-b binding protein 95 312 - -
Ccar2g01972 316 Gene3D Chlorophyll a-b binding protein domain 97 315 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Ccar2g01972 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Ccar Ccar-Chr1:17152493 Ccar2g01972 Ccar-Chr2:66476437 dispersed
Ccar Ccar-Chr2:4074975 Ccar2g01972 Ccar-Chr2:66476437 dispersed
Ccar Ccar-Chr2:66476437 Ccar3g01218 Ccar-Chr3:32499019 dispersed
Ccar Ccar-Chr17:3128819 Ccar2g01972 Ccar-Chr2:66476437 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Ccar14g00271 . 2 267 Chloroplast and Mitochondria gene family AT1G29930 87.594 5.87e-172 473.0
Ccar14g00263 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 6.29e-171 471.0
Ccar14g00264 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 3.84e-172 474.0
Ccar14g00262 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 7.02e-172 473.0
Ccar14g00259 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 1.17e-171 473.0
Ccar14g00252 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 5.70e-172 473.0
Ccar16g00445 . 139 303 Chloroplast and Mitochondria gene family AT2G17270 48.193 2.84e-48 159.0
Ccar7g00251 . 7 315 Chloroplast and Mitochondria gene family AT5G15640 59.547 2.01e-122 353.0
Ccar7g00031 ACH 21 307 Chloroplast and Mitochondria gene family AT5G40810 87.586 1.15e-177 494.0
Ccar8g01134 . 5 187 Chloroplast and Mitochondria gene family AT1G17530 65.241 1.52e-74 220.0
Ccar8g00895 . 1 221 Chloroplast and Mitochondria gene family AT2G05100 62.946 2.89e-85 253.0
Ccar8g00622 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 74.517 1.72e-129 364.0
Ccar9g00532 . 29 302 Chloroplast and Mitochondria gene family AT2G47490 77.818 1.02e-155 437.0
Ccar9g00262 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 86.496 7.58e-167 462.0
Ccar15g00817 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 77.578 4.31e-120 340.0
Ccar15g00452 ACH 1 305 Chloroplast and Mitochondria gene family AT2G17270 64.262 3.82e-147 413.0
Ccar15g00196 . 10 236 Chloroplast and Mitochondria gene family AT1G26100 67.089 4.02e-97 281.0
Ccar12g01116 . 204 309 Chloroplast and Mitochondria gene family AT2G17270 57.407 2.06e-39 131.0
Ccar12g00515 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.24e-172 475.0
Ccar12g00413 . 62 131 Chloroplast and Mitochondria gene family AT4G25570 45.714 7.74e-10 56.2
Ccar4g00729 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 75.0 0.0 548.0
Ccar6g00872 . 32 218 Chloroplast and Mitochondria gene family AT3G61470 51.872 3.33e-60 188.0
Ccar6g00714 ACH 1 372 Chloroplast and Mitochondria gene family AT5G14040 68.28 1.22e-173 485.0
Ccar6g00635 . 57 354 Chloroplast and Mitochondria gene family AT5G54290 54.455 8.18e-79 241.0
Ccar6g00631 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.164 3.59e-122 347.0
Ccar6g00153 . 41 316 Chloroplast and Mitochondria gene family AT1G07030 33.094 5.48e-34 125.0
Ccar6g00023 . 132 192 Chloroplast and Mitochondria gene family AT5G14040 43.284 6.95e-09 52.4
Ccar10g00272 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 3.96e-155 468.0
Ccar10g00271 . 1 95 Chloroplast and Mitochondria gene family AT1G29930 77.895 1.39e-43 140.0
Ccar10g00274 . 106 263 Chloroplast and Mitochondria gene family AT2G34430 88.608 8.27e-94 274.0
Ccar10g00273 . 168 265 Chloroplast and Mitochondria gene family AT2G05070 86.735 3.88e-59 180.0
Ccar17g00898 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.052 2.50e-159 448.0
Ccar17g00579 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.008 1.35e-150 419.0
Ccar17g00320 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 84.151 8.25e-165 454.0
Ccar17g00283 . 108 237 Chloroplast and Mitochondria gene family AT1G61520 40.0 4.05e-20 81.6
Ccar5g01390 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 63.158 2.59e-105 302.0
Ccar5g01144 ACH 93 300 Chloroplast and Mitochondria gene family AT2G47490 35.023 1.37e-30 117.0
Ccar5g00814 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 27.385 4.92e-30 116.0
Ccar5g00681 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 81.022 2.44e-158 440.0
Ccar5g00279 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 62.5 6.52e-33 106.0
Ccar5g00316 ACH 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.037 9.76e-168 468.0
Ccar13g01623 . 46 136 Chloroplast and Mitochondria gene family AT1G29930 79.121 2.39e-49 155.0
Ccar13g01622 . 174 265 Chloroplast and Mitochondria gene family AT2G05070 85.87 1.59e-49 166.0
Ccar13g01298 . 66 271 Chloroplast and Mitochondria gene family AT4G03320 36.697 2.19e-45 152.0
Ccar13g00792 ACH 1 197 Chloroplast and Mitochondria gene family AT3G54890 80.808 7.40e-111 315.0
Ccar13g00729 . 36 225 Chloroplast and Mitochondria gene family AT1G07030 29.167 5.98e-20 85.9
Ccar13g00412 . 150 352 Chloroplast and Mitochondria gene family AT1G25380 57.488 1.12e-77 235.0
Ccar13g00081 . 42 407 Chloroplast and Mitochondria gene family AT2G28800 59.788 3.23e-150 435.0
Ccar3g01761 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 70.141 1.78e-178 497.0
Ccar3g01619 . 5 307 Chloroplast and Mitochondria gene family AT5G40810 75.817 1.68e-151 425.0
Ccar3g01496 ACH 1 242 Chloroplast and Mitochondria gene family AT5G14040 68.443 1.46e-109 326.0
Ccar3g01218 ACH 35 255 Chloroplast and Mitochondria gene family AT3G61470 49.321 3.00e-70 214.0
Ccar3g00938 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 68.929 7.03e-123 348.0
Ccar3g00504 . 19 300 Chloroplast and Mitochondria gene family AT4G25700 62.424 6.36e-141 401.0
Ccar1g02577 . 40 327 Chloroplast and Mitochondria gene family AT1G76570 80.556 4.63e-177 491.0
Ccar1g01652 . 2 267 Chloroplast and Mitochondria gene family AT1G29930 76.316 1.75e-141 395.0
Ccar1g01670 . 180 313 Chloroplast and Mitochondria gene family AT1G25380 26.282 1.90e-06 46.6
Ccar1g01504 . 5 303 Chloroplast and Mitochondria gene family AT2G17270 66.89 8.44e-154 431.0
Ccar1g01466 . 69 273 Chloroplast and Mitochondria gene family AT1G61520 93.659 3.79e-144 403.0
Ccar1g01422 ACH 159 300 Chloroplast and Mitochondria gene family AT2G47490 39.333 1.43e-22 95.1
Ccar1g01192 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 70.175 8.20e-119 336.0
Ccar1g01013 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.774 0.0 514.0
Ccar1g00972 . 2 365 Chloroplast and Mitochondria gene family AT5G14040 78.297 0.0 577.0
Ccar1g00490 ACH 1 239 Chloroplast and Mitochondria gene family AT3G54890 83.75 3.02e-146 406.0
Ccar1g00315 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 25.079 5.64e-25 102.0
Ccar1g00084 . 1 215 Chloroplast and Mitochondria gene family AT4G25570 46.047 1.84e-53 167.0
Ccar2g02060 . 46 265 Chloroplast and Mitochondria gene family AT2G05100 75.785 1.28e-119 340.0
Ccar2g01972 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 89.844 3.16e-171 474.0
Ccar2g01248 . 3 143 Chloroplast and Mitochondria gene family AT1G07020 47.552 8.82e-30 104.0
Ccar2g01083 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 5.06e-33 106.0
Ccar2g01079 ACH 1 338 Chloroplast and Mitochondria gene family AT1G72820 66.864 2.02e-152 435.0
Ccar2g00786 . 60 548 Chloroplast and Mitochondria gene family AT2G18710 79.141 0.0 759.0
Ccar2g00347 ACH 51 257 Chloroplast and Mitochondria gene family AT3G61470 68.599 3.85e-103 299.0