AGRP
Asteraceae Genomic Research Platform
Asteraceae Genomic Research Platform
| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Ceso2g01526 | ATGAAAGTGGACCAACAATTCACCCAACACCATCCACCACCACGTGACGACCTCTGCCGCACCATTGAAGTCGTTCATCCCAAGCTATCAACAACAACTATGCTCACTGATGATGATACCTTCGATTCCAATGGCGACGATGAACAGCTCTACACTCCTCCTCTCAATTTCTCCATGGTCGATAATGGCATATTCCGTTCCGGATTCCCTGATACCGCTAACTTCTCCTTTCTCAAAACCCTAGGCCTTCGCTCTATTGTATATTTGTGTCCTGAGCCGTATCCGGAGCATAACGTGGAATTTTTGAAGGCTAATCGGATTCGGTTGTTTCAGTTTGGAATTGAAGGCACTAAGGAACCTTTCGTCAATATTCCTGAGAACCTAATTCGCGAAGCATTAAAAGTTGTTCTTGATGTAAGAAATCACCCAGTATTGATTCATTGCAAAAGAGGAAAGCACCGAACTGGTTGTCTAGTAGGATGCTTGAGAAAAATTCAAAGATGGTGCCTCACTTCAATCTTTGATGAGTACCAAAGGTTTGCAGCTGCCAAGGCTAGACTTTCAGATCAGAGGTTTATGGAGCTGTTCGATACCTCTAGCTTCAAGGATATACCACCATGCCCATGTTCATGTTCGAAGAGGTAA | 645 | 44.03 | MKVDQQFTQHHPPPRDDLCRTIEVVHPKLSTTTMLTDDDTFDSNGDDEQLYTPPLNFSMVDNGIFRSGFPDTANFSFLKTLGLRSIVYLCPEPYPEHNVEFLKANRIRLFQFGIEGTKEPFVNIPENLIREALKVVLDVRNHPVLIHCKRGKHRTGCLVGCLRKIQRWCLTSIFDEYQRFAAAKARLSDQRFMELFDTSSFKDIPPCPCSCSKR | 214 |
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Ceso2g01526 | 214 | ProSiteProfiles | Dual specificity protein phosphatase domain profile. | 56 | 207 | IPR020422 | GO:0006470(InterPro) | |
| Ceso2g01526 | 214 | PANTHER | TYROSINE-PROTEIN PHOSPHATASE | 39 | 205 | - | GO:0005737(PANTHER)|GO:0016791(PANTHER) | |
| Ceso2g01526 | 214 | CDD | PFA-DSP-Siw14 | 50 | 197 | - | - | |
| Ceso2g01526 | 214 | Gene3D | Protein tyrosine phosphatase superfamily | 51 | 200 | IPR029021 | - | |
| Ceso2g01526 | 214 | SUPERFAMILY | (Phosphotyrosine protein) phosphatases II | 51 | 197 | IPR029021 | - | |
| Ceso2g01526 | 214 | ProSitePatterns | Tyrosine specific protein phosphatases active site. | 146 | 156 | IPR016130 | GO:0016311(InterPro) | |
| Ceso2g01526 | 214 | PRINTS | Plant and fungal dual specificity phosphatase signature | 124 | 138 | IPR020428 | GO:0016791(InterPro) | |
| Ceso2g01526 | 214 | PRINTS | Plant and fungal dual specificity phosphatase signature | 88 | 101 | IPR020428 | GO:0016791(InterPro) | |
| Ceso2g01526 | 214 | PRINTS | Plant and fungal dual specificity phosphatase signature | 51 | 68 | IPR020428 | GO:0016791(InterPro) | |
| Ceso2g01526 | 214 | PRINTS | Plant and fungal dual specificity phosphatase signature | 107 | 121 | IPR020428 | GO:0016791(InterPro) | |
| Ceso2g01526 | 214 | Pfam | Tyrosine phosphatase family | 53 | 204 | IPR004861 | - | |
| Ceso2g01526 | 214 | FunFam | probable tyrosine-protein phosphatase At1g05000 | 50 | 200 | - | - |
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Ceso2g01526 | K18045 | tyrosine-protein phosphatase SIW14 [EC:3.1.3.48] |
| Select | Gene_1 | Gene_2 | Event_name |
|---|---|---|---|
| 40251 | Ceso2g01526 | Ceso4g01751 |
| Select | Gene1 | Location1 | Gene2 | Location2 | Duplicated-type |
|---|---|---|---|---|---|
| Ceso | Ceso-Chr1:55321036 | Ceso2g01526 | Ceso-Chr2:32367636 | dispersed | |
| Ceso | Ceso-Chr2:32367636 | Ceso6g03198 | Ceso-Chr6:80969922 | dispersed | |
| Ceso | Ceso-Chr4:31165589 | Ceso2g01526 | Ceso-Chr2:32367636 | transposed | |
| Ceso | Ceso-Chr2:32367636 | Ceso7g03067 | Ceso-Chr7:65199597 | wgd |
| Select | Gene | Event_type | S_start | S_end | Function | Ath_gene | Identity(%) | E-value | Score |
|---|---|---|---|---|---|---|---|---|---|
| Ceso8g00597 | . | 265 | 348 | Protein tyrosine phosphatase (PTP) family | AT3G52180 | 32.979 | 5.83e-07 | 49.7 | |
| Ceso8g01642 | . | 21 | 190 | Protein tyrosine phosphatase (PTP) family | AT3G23610 | 61.176 | 3.40e-72 | 215.0 | |
| Ceso7g00700 | ACH | 18 | 840 | Protein tyrosine phosphatase (PTP) family | AT3G10550 | 60.976 | 0.0 | 1049.0 | |
| Ceso7g01114 | . | 62 | 590 | Protein tyrosine phosphatase (PTP) family | AT3G01510 | 71.617 | 0.0 | 801.0 | |
| Ceso7g03067 | . | 5 | 191 | Protein tyrosine phosphatase (PTP) family | AT3G02800 | 62.755 | 5.58e-89 | 259.0 | |
| Ceso6g00167 | . | 201 | 653 | Protein tyrosine phosphatase (PTP) family | AT5G01290 | 56.604 | 2.24e-180 | 518.0 | |
| Ceso6g01086 | . | 98 | 186 | Protein tyrosine phosphatase (PTP) family | AT3G23610 | 43.011 | 1.83e-17 | 78.2 | |
| Ceso6g02571 | . | 70 | 376 | Protein tyrosine phosphatase (PTP) family | AT3G52180 | 66.234 | 6.75e-152 | 431.0 | |
| Ceso6g03198 | . | 4 | 191 | Protein tyrosine phosphatase (PTP) family | AT3G02800 | 54.255 | 3.31e-69 | 208.0 | |
| Ceso5g01719 | ACH | 34 | 227 | Protein tyrosine phosphatase (PTP) family | AT5G56610 | 71.066 | 4.51e-99 | 287.0 | |
| Ceso5g02336 | . | 1 | 399 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 59.057 | 4.47e-167 | 524.0 | |
| Ceso5g02335 | . | 7 | 399 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 57.935 | 3.77e-148 | 494.0 | |
| Ceso5g02582 | . | 1 | 653 | Protein tyrosine phosphatase (PTP) family | AT5G01290 | 64.602 | 0.0 | 849.0 | |
| Ceso5g02330 | . | 800 | 1304 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 53.199 | 2.23e-165 | 523.0 | |
| Ceso5g02327 | . | 1 | 399 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 58.561 | 1.79e-167 | 506.0 | |
| Ceso5g02326 | ACH | 7 | 399 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 57.683 | 2.40e-156 | 497.0 | |
| Ceso5g03822 | . | 43 | 325 | Protein tyrosine phosphatase (PTP) family | AT2G35680 | 57.84 | 9.61e-115 | 333.0 | |
| Ceso4g00953 | ACH | 1 | 425 | Protein tyrosine phosphatase (PTP) family | AT5G58160 | 60.599 | 0.0 | 566.0 | |
| Ceso4g01228 | ACH | 34 | 227 | Protein tyrosine phosphatase (PTP) family | AT5G56610 | 71.134 | 8.55e-101 | 293.0 | |
| Ceso4g01751 | ACH | 13 | 203 | Protein tyrosine phosphatase (PTP) family | AT1G05000 | 64.615 | 1.13e-90 | 263.0 | |
| Ceso4g03469 | . | 1 | 767 | Protein tyrosine phosphatase (PTP) family | AT3G55270 | 49.883 | 0.0 | 736.0 | |
| Ceso4g03704 | ACH | 6 | 840 | Protein tyrosine phosphatase (PTP) family | AT3G10550 | 65.263 | 0.0 | 1128.0 | |
| Ceso3g00891 | . | 76 | 159 | Protein tyrosine phosphatase (PTP) family | AT3G01510 | 27.381 | 2.59e-06 | 47.0 | |
| Ceso3g01457 | . | 15 | 303 | Protein tyrosine phosphatase (PTP) family | AT2G35320 | 50.333 | 5.94e-103 | 301.0 | |
| Ceso3g04329 | . | 11 | 239 | Protein tyrosine phosphatase (PTP) family | AT3G44620 | 61.411 | 3.25e-93 | 272.0 | |
| Ceso2g01526 | ACH | 1 | 215 | Protein tyrosine phosphatase (PTP) family | AT1G05000 | 67.593 | 1.78e-100 | 288.0 | |
| Ceso1g00279 | . | 27 | 611 | Protein tyrosine phosphatase (PTP) family | AT3G19420 | 60.033 | 0.0 | 712.0 | |
| Ceso1g00132 | . | 32 | 396 | Protein tyrosine phosphatase (PTP) family | AT5G39400 | 63.315 | 3.93e-168 | 475.0 | |
| Ceso1g02313 | . | 24 | 210 | Protein tyrosine phosphatase (PTP) family | AT1G05000 | 62.434 | 1.15e-77 | 236.0 | |
| Ceso1g02370 | ACH | 447 | 534 | Protein tyrosine phosphatase (PTP) family | AT3G01510 | 30.097 | 4.03e-06 | 46.2 |