AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Chmo14g00710 ATGGCAACTCAAGCTTTGGTCTCATCATCATCACTCACATCCTCAGTTGAGTCTGCTAGACAAATCCTTGGTGCAAGACCAGCTTTCACACCAACAAGAAAAGTTTCATTTGTTGTCAAAGCTGCTTCCACCCCTCCTGTTAAGCAAGGAGACAGACAACTATGGTTTGCATCCAAGCAATCTCTTTCTTACCTGGATGGAACTCTCCCAGGTGACTATGGATTCGACCCACTTGGTCTTTCCGACCCAGAAGGGACCGGAGGATTCATTGAACCCAAGTGGCTAGCTTACGGAGAGGTTTTCAATGGACGGTTTGCCATGTTGGGTGCGGTCGGAGCTATTGCACCCGAAATTCTAGGCAAGCTTGGACTCATCCCAGCTGAAACTGCCCTTCCATGGTTCAAGACCGGTGTCATCCCCCCAGCCGGCACATACAACTACTGGGCTGACCCTTTCACCCTATTTGTATTCGAAATGGCACTTATGGGCTTTGCAGAACACAGAAGACTACAAGATTGGTACAACCCAGGATCCATGGGAAAACAATACTTTTTGGGTTTAGAAAAAGGGTTTTCAGGGTCGGGCGACCCAGCATACCCAGGTGGCCCGTTCTTTAACCCTCTTGGGTTTGGGAAAGATGAGAAGTCAATGAAGGAATTGAAGCTAAAAGAGATCAAGAACGGTAGATTGGCTATGTTGGCTATCTTAGGTTACTTCATTCAGGGTTTGGTGACTGGGGTTGGACCTTTTCAGAACCTTTTGGATCATTTGGCTGATCCTGTCAACAACAATGTCTTGACCAGCCTTAAGTTCCACTAG 819 47.37 MATQALVSSSSLTSSVESARQILGARPAFTPTRKVSFVVKAASTPPVKQGDRQLWFASKQSLSYLDGTLPGDYGFDPLGLSDPEGTGGFIEPKWLAYGEVFNGRFAMLGAVGAIAPEILGKLGLIPAETALPWFKTGVIPPAGTYNYWADPFTLFVFEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 272
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Chmo14g00710 272 Gene3D Chlorophyll a-b binding protein domain 53 271 - -
Chmo14g00710 272 FunFam Chlorophyll a-b binding protein, chloroplastic 53 271 - -
Chmo14g00710 272 SUPERFAMILY Chlorophyll a-b binding protein 51 268 - -
Chmo14g00710 272 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 4 267 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Chmo14g00710 272 Pfam Chlorophyll A-B binding protein 63 242 IPR022796 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Chmo14g00710 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Chmo Chmo-Chr14:32646339 Chmo4g03393 Chmo-Chr4:226080496 dispersed
Chmo Chmo-Chr13:34533639 Chmo14g00710 Chmo-Chr14:32646339 wgd
Chmo Chmo-Chr14:32646339 Chmo15g00593 Chmo-Chr15:31563676 wgd
Chmo Chmo-Chr14:32646339 Chmo22g04848 Chmo-Chr22:293340224 wgd
Chmo Chmo-Chr14:32646339 Chmo23g04802 Chmo-Chr23:285931692 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Chmo12g01045 CSH 4 214 Chloroplast and Mitochondria gene family AT4G25570 41.706 1.17e-55 176.0
Chmo21g01764 CSH 3 145 Chloroplast and Mitochondria gene family AT1G07020 50.0 1.69e-30 106.0
Chmo14g00879 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 4.51e-122 347.0
Chmo2g04131 ACH,CSH 1 345 Chloroplast and Mitochondria gene family AT1G72820 66.957 1.79e-158 446.0
Chmo1g02817 . 144 205 Chloroplast and Mitochondria gene family AT3G61470 46.774 4.41e-11 55.1
Chmo14g03296 . 154 194 Chloroplast and Mitochondria gene family AT3G54890 78.571 2.98e-12 62.8
Chmo2g00935 . 150 319 Chloroplast and Mitochondria gene family AT1G25380 63.529 2.58e-82 246.0
Chmo2g00934 . 33 145 Chloroplast and Mitochondria gene family AT1G25380 72.414 5.19e-50 161.0
Chmo16g02052 . 67 255 Chloroplast and Mitochondria gene family AT3G61470 54.497 1.71e-67 206.0
Chmo6g02749 . 37 251 Chloroplast and Mitochondria gene family AT3G61470 47.248 5.66e-63 197.0
Chmo23g04728 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 4.29e-179 491.0
Chmo23g04727 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.811 0.0 498.0
Chmo5g03409 . 132 266 Chloroplast and Mitochondria gene family AT2G34430 89.63 9.81e-84 246.0
Chmo13g00926 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 7.14e-122 346.0
Chmo9g02997 . 1 372 Chloroplast and Mitochondria gene family AT5G14040 78.016 0.0 580.0
Chmo8g02950 . 1 372 Chloroplast and Mitochondria gene family AT5G14040 78.075 0.0 581.0
Chmo9g02221 . 2 304 Chloroplast and Mitochondria gene family AT2G17270 66.667 5.91e-153 429.0
Chmo22g02437 . 42 124 Chloroplast and Mitochondria gene family AT1G26100 69.88 4.80e-35 117.0
Chmo18g01182 . 72 369 Chloroplast and Mitochondria gene family AT5G14040 81.544 0.0 521.0
Chmo15g00706 . 165 379 Chloroplast and Mitochondria gene family AT4G21490 61.111 1.74e-73 237.0
Chmo3g03131 . 244 315 Chloroplast and Mitochondria gene family AT5G14040 54.167 1.43e-17 74.3
Chmo17g03689 CSH 72 404 Chloroplast and Mitochondria gene family AT2G28800 60.955 2.39e-151 439.0
Chmo5g02409 CSH 1 315 Chloroplast and Mitochondria gene family AT5G15640 76.19 5.84e-180 499.0
Chmo8g02241 . 5 304 Chloroplast and Mitochondria gene family AT2G17270 67.0 3.05e-153 430.0
Chmo16g01554 . 34 255 Chloroplast and Mitochondria gene family AT3G61470 51.802 3.85e-73 222.0
Chmo17g01388 . 34 255 Chloroplast and Mitochondria gene family AT3G61470 51.802 4.89e-73 221.0
Chmo3g04546 CSH 1 347 Chloroplast and Mitochondria gene family AT1G72820 67.147 2.25e-158 445.0
Chmo24g01083 . 107 228 Chloroplast and Mitochondria gene family AT5G14040 73.77 1.69e-58 186.0
Chmo22g00998 . 107 218 Chloroplast and Mitochondria gene family AT5G14040 73.214 4.84e-53 172.0
Chmo3g01719 CSH 10 187 Chloroplast and Mitochondria gene family AT1G17530 64.088 3.71e-73 217.0
Chmo22g04226 ACH,CSH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.008 3.97e-150 417.0
Chmo26g01652 . 59 356 Chloroplast and Mitochondria gene family AT5G14040 54.369 3.37e-115 336.0
Chmo26g01653 . 5 373 Chloroplast and Mitochondria gene family AT5G14040 77.568 0.0 573.0
Chmo22g04848 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 85.766 1.99e-168 468.0
Chmo24g04742 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 4.29e-179 491.0
Chmo24g04741 . 107 266 Chloroplast and Mitochondria gene family AT3G27690 91.875 9.53e-108 306.0
Chmo8g03016 ACH,CSH 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.174 0.0 508.0
Chmo1g02616 . 70 215 Chloroplast and Mitochondria gene family AT3G27240 72.0 9.33e-65 199.0
Chmo1g02658 ACH,CSH 1 250 Chloroplast and Mitochondria gene family AT1G15820 80.632 3.74e-142 404.0
Chmo3g02616 ACH,CSH 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.375 3.84e-150 417.0
Chmo1g04552 ACH,CSH 1 345 Chloroplast and Mitochondria gene family AT1G72820 66.957 9.44e-158 444.0
Chmo1g03672 ACH,CSH 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 2.23e-35 112.0
Chmo1g01765 CSH 10 187 Chloroplast and Mitochondria gene family AT1G17530 64.641 9.14e-74 218.0
Chmo9g02372 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.786 2.71e-47 159.0
Chmo3g04252 CSH 2 308 Chloroplast and Mitochondria gene family AT2G47490 74.516 7.05e-158 441.0
Chmo5g01565 . 106 241 Chloroplast and Mitochondria gene family AT5G14040 78.676 1.12e-72 222.0
Chmo5g04578 CSH 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.208 1.46e-170 476.0
Chmo25g00712 ACH,CSH 174 303 Chloroplast and Mitochondria gene family AT1G25380 34.307 1.71e-18 79.0
Chmo1g01105 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 4.54e-168 463.0
Chmo1g01103 . 113 265 Chloroplast and Mitochondria gene family AT2G05070 77.124 2.32e-82 242.0
Chmo4g03393 . 38 251 Chloroplast and Mitochondria gene family AT3G61470 47.005 3.75e-62 196.0
Chmo10g01022 CSH 98 218 Chloroplast and Mitochondria gene family AT1G14730 33.058 2.63e-15 68.6
Chmo5g03951 . 5 367 Chloroplast and Mitochondria gene family AT5G14040 69.421 2.09e-179 500.0
Chmo13g00724 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.109 4.49e-165 456.0
Chmo2g03277 ACH,CSH 1 57 Chloroplast and Mitochondria gene family AT5G05370 70.175 9.00e-27 91.3
Chmo8g03280 ACH,CSH 1 228 Chloroplast and Mitochondria gene family AT5G38630 69.298 1.43e-117 333.0
Chmo11g03978 . 121 242 Chloroplast and Mitochondria gene family AT5G14040 81.148 1.76e-66 206.0
Chmo8g04538 CSH 1 215 Chloroplast and Mitochondria gene family AT4G25570 68.519 2.31e-105 302.0
Chmo23g03004 . 1 263 Chloroplast and Mitochondria gene family AT1G29930 77.947 5.06e-141 395.0
Chmo23g03005 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 1.39e-167 462.0
Chmo23g02997 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 3.19e-168 464.0
Chmo23g03002 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 84.644 3.55e-166 459.0
Chmo23g02998 . 61 267 Chloroplast and Mitochondria gene family AT1G29930 79.71 1.52e-113 322.0
Chmo23g03003 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 6.24e-168 463.0
Chmo23g03000 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 84.644 2.09e-166 459.0
Chmo23g03001 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 4.15e-170 469.0
Chmo23g02999 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 1.23e-168 465.0
Chmo25g01113 . 9 228 Chloroplast and Mitochondria gene family AT5G38630 67.873 3.92e-110 314.0
Chmo1g03434 ACH,CSH 43 445 Chloroplast and Mitochondria gene family AT2G28800 74.94 0.0 605.0
Chmo5g00974 . 86 267 Chloroplast and Mitochondria gene family AT5G40810 79.67 7.81e-92 272.0
Chmo25g01664 CSH 9 236 Chloroplast and Mitochondria gene family AT1G26100 65.401 8.36e-96 280.0
Chmo4g00876 . 350 416 Chloroplast and Mitochondria gene family AT4G21490 55.224 1.67e-19 79.0
Chmo2g02418 ACH 1 250 Chloroplast and Mitochondria gene family AT1G15820 80.632 4.61e-142 404.0
Chmo23g03073 CSH 93 271 Chloroplast and Mitochondria gene family AT4G03320 39.674 1.42e-42 144.0
Chmoscaffold_710__frag0ment_1g00054 . 297 416 Chloroplast and Mitochondria gene family AT4G21490 64.463 2.96e-50 169.0
Chmo14g03106 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 67.15 1.24e-102 298.0
Chmo20g01225 . 49 199 Chloroplast and Mitochondria gene family AT1G76570 67.55 3.58e-73 222.0
Chmo14g05047 . 71 255 Chloroplast and Mitochondria gene family AT3G61470 52.432 4.96e-61 189.0
Chmo16g02564 . 257 326 Chloroplast and Mitochondria gene family AT5G14040 41.429 1.40e-09 51.6
Chmo5g02987 . 234 416 Chloroplast and Mitochondria gene family AT4G21490 66.848 7.53e-87 265.0
Chmo13g01985 . 1 54 Chloroplast and Mitochondria gene family AT5G05370 70.37 6.96e-25 85.5
Chmo22g03848 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.5 2.69e-144 401.0
Chmo5g01125 CSH 29 300 Chloroplast and Mitochondria gene family AT4G25700 68.166 2.61e-142 402.0
Chmo6g03184 . 38 255 Chloroplast and Mitochondria gene family AT3G61470 52.752 6.45e-76 229.0
Chmo3g01471 CSH 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.435 9.42e-167 467.0
Chmo14g00560 . 49 229 Chloroplast and Mitochondria gene family AT1G76570 72.928 1.75e-97 283.0
Chmo19g02086 CSH 3 145 Chloroplast and Mitochondria gene family AT1G07020 50.685 1.12e-30 106.0
Chmo27g01710 ACH 33 319 Chloroplast and Mitochondria gene family AT1G25380 66.552 1.07e-142 405.0
Chmo27g01690 CSH 33 319 Chloroplast and Mitochondria gene family AT1G25380 59.31 1.75e-118 342.0
Chmo16g04204 . 56 126 Chloroplast and Mitochondria gene family AT1G29930 84.507 1.42e-36 132.0
Chmo26g01808 CSH 9 236 Chloroplast and Mitochondria gene family AT1G26100 66.245 2.76e-97 282.0
Chmo26g01773 ACH 136 158 Chloroplast and Mitochondria gene family AT3G27240 100.0 1.43e-10 54.3
Chmo27g01637 CSH 9 236 Chloroplast and Mitochondria gene family AT1G26100 65.823 4.68e-97 283.0
Chmo4g02546 CSH 1 320 Chloroplast and Mitochondria gene family AT5G15640 76.25 0.0 510.0
Chmo22g00777 . 1 364 Chloroplast and Mitochondria gene family AT5G14040 76.923 0.0 558.0
Chmo7g01904 . 5 304 Chloroplast and Mitochondria gene family AT2G17270 67.333 4.42e-153 430.0
Chmo16g02900 CSH 8 223 Chloroplast and Mitochondria gene family AT1G14730 59.259 2.94e-87 255.0
Chmo16g02902 CSH 80 220 Chloroplast and Mitochondria gene family AT5G38630 29.577 4.46e-14 65.5
Chmo16g02901 . 4 64 Chloroplast and Mitochondria gene family AT4G25570 43.548 2.25e-12 57.8
Chmo3g03434 ACH,CSH 120 445 Chloroplast and Mitochondria gene family AT2G28800 81.402 0.0 530.0
Chmo24g02432 CSH 1 187 Chloroplast and Mitochondria gene family AT1G17530 62.567 1.08e-73 218.0
Chmo16g02255 CSH 65 217 Chloroplast and Mitochondria gene family AT3G61470 54.248 4.78e-54 170.0
Chmo16g02257 . 65 255 Chloroplast and Mitochondria gene family AT3G61470 52.356 1.25e-64 198.0
Chmo17g03205 ACH,CSH 33 317 Chloroplast and Mitochondria gene family AT1G25380 66.319 1.82e-136 390.0
Chmo15g04142 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 88.593 4.75e-169 466.0
Chmo15g04145 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 87.833 1.35e-167 462.0
Chmo15g04143 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 88.593 4.75e-169 466.0
Chmo15g04147 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 1.68e-172 474.0
Chmo7g03736 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 81.667 8.34e-142 395.0
Chmoscaffold_956__frag0ment_2g00009 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 79.845 2.85e-148 412.0
Chmo23g02531 CSH 1 187 Chloroplast and Mitochondria gene family AT1G17530 62.032 7.63e-73 216.0
Chmo9g03784 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 81.667 8.34e-142 395.0
Chmo14g04217 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 88.593 4.75e-169 466.0
Chmo10g01262 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.567 9.43e-168 462.0
Chmo1g03597 . 47 325 Chloroplast and Mitochondria gene family AT1G76570 64.894 4.01e-127 368.0
Chmo1g03595 ACH,CSH 3 327 Chloroplast and Mitochondria gene family AT2G30160 69.091 1.44e-157 442.0
Chmo3g03627 ACH,CSH 3 327 Chloroplast and Mitochondria gene family AT2G30160 69.091 1.44e-157 442.0
Chmo18g03806 . 168 266 Chloroplast and Mitochondria gene family AT2G34430 89.899 9.96e-59 179.0
Chmo18g03808 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 84.701 9.05e-165 455.0
Chmo18g03807 . 1 172 Chloroplast and Mitochondria gene family AT1G29910 80.925 1.43e-99 287.0
Chmo21g01593 . 49 327 Chloroplast and Mitochondria gene family AT1G76570 73.477 1.21e-156 442.0
Chmo1g01497 CSH 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.435 3.84e-167 468.0
Chmo16g01255 . 1 268 Chloroplast and Mitochondria gene family AT5G14040 69.403 2.99e-133 379.0
Chmo8g04211 . 37 316 Chloroplast and Mitochondria gene family AT1G25380 25.49 1.57e-29 115.0
Chmo5g03069 . 32 280 Chloroplast and Mitochondria gene family AT4G10340 87.6 5.57e-146 409.0
Chmo5g03068 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 86.022 1.40e-155 433.0
Chmo12g00165 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.307 1.58e-162 451.0
Chmo8g03887 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 81.667 9.10e-142 395.0
Chmo8g00023 . 27 325 Chloroplast and Mitochondria gene family AT1G76570 75.92 1.76e-175 488.0
Chmo12g00570 . 245 299 Chloroplast and Mitochondria gene family AT5G14040 65.455 3.43e-19 79.7
Chmo25g01527 . 5 373 Chloroplast and Mitochondria gene family AT5G14040 78.108 0.0 578.0
Chmo25g01526 . 108 316 Chloroplast and Mitochondria gene family AT5G14040 56.938 5.60e-75 229.0
Chmo6g01653 ACH,CSH 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.936 0.0 503.0
Chmo6g01645 . 163 327 Chloroplast and Mitochondria gene family AT1G76570 82.424 2.12e-99 289.0
Chmo22g03017 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 2.62e-165 456.0
Chmo22g03016 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 1.39e-167 462.0
Chmo23g04802 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 85.766 8.09e-168 463.0
Chmo23g02201 . 154 196 Chloroplast and Mitochondria gene family AT3G54890 67.442 2.95e-12 62.0
Chmo2g03845 CSH 2 308 Chloroplast and Mitochondria gene family AT2G47490 74.516 7.05e-158 441.0
Chmo9g01559 . 61 177 Chloroplast and Mitochondria gene family AT1G25380 64.167 3.02e-43 144.0
Chmo22g04596 . 229 316 Chloroplast and Mitochondria gene family AT1G76570 53.608 1.68e-22 98.2
Chmo2g01501 CSH 10 159 Chloroplast and Mitochondria gene family AT1G17530 63.399 1.10e-66 202.0
Chmo4g00346 . 135 211 Chloroplast and Mitochondria gene family AT5G38630 67.532 2.12e-32 116.0
Chmo26g02462 . 31 565 Chloroplast and Mitochondria gene family AT4G21490 69.517 0.0 758.0
Chmo23g04259 CSH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.008 3.97e-150 417.0
Chmo18g01051 CSH 5 354 Chloroplast and Mitochondria gene family AT5G54290 67.978 1.50e-147 419.0
Chmo18g01044 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.98e-122 348.0
Chmo27g01098 ACH,CSH 2 228 Chloroplast and Mitochondria gene family AT5G38630 66.228 5.67e-109 311.0
Chmo2g03010 ACH,CSH 43 445 Chloroplast and Mitochondria gene family AT2G28800 74.82 0.0 607.0
Chmo12g01276 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.567 9.43e-168 462.0
Chmo4g04222 . 5 367 Chloroplast and Mitochondria gene family AT5G14040 69.231 1.75e-178 498.0
Chmo5g03652 . 38 255 Chloroplast and Mitochondria gene family AT3G61470 52.752 2.63e-75 227.0
Chmo24g01924 . 91 205 Chloroplast and Mitochondria gene family AT3G61470 44.348 2.73e-26 97.8
Chmo11g01024 . 4 214 Chloroplast and Mitochondria gene family AT4G25570 41.232 3.39e-55 174.0
Chmo11g01023 CSH 22 224 Chloroplast and Mitochondria gene family AT5G38630 37.443 2.64e-51 164.0
Chmo4g01200 CSH 29 300 Chloroplast and Mitochondria gene family AT4G25700 70.652 6.04e-144 405.0
Chmo15g02812 . 97 212 Chloroplast and Mitochondria gene family AT3G27240 83.621 1.40e-59 188.0
Chmo15g02811 . 109 211 Chloroplast and Mitochondria gene family AT3G27240 84.466 1.32e-51 162.0
Chmo4g04808 CSH 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.103 6.94e-172 480.0
Chmo6g04368 ACH,CSH 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.391 1.53e-172 481.0
Chmo22g03086 CSH 93 271 Chloroplast and Mitochondria gene family AT4G03320 39.674 3.48e-42 145.0
Chmo19g00573 . 132 173 Chloroplast and Mitochondria gene family AT5G54290 90.476 4.86e-18 77.4
Chmo24g01603 . 113 265 Chloroplast and Mitochondria gene family AT2G05070 74.51 1.19e-79 235.0
Chmo11g01903 . 113 265 Chloroplast and Mitochondria gene family AT2G05070 66.667 1.73e-67 203.0
Chmo9g04156 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 26.0 4.47e-29 113.0
Chmo27g02088 . 136 270 Chloroplast and Mitochondria gene family AT5G40810 88.148 2.66e-86 253.0
Chmo7g02821 . 54 372 Chloroplast and Mitochondria gene family AT5G14040 85.893 0.0 567.0
Chmo13g04344 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 1.68e-172 474.0
Chmo13g04345 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 2.97e-173 476.0
Chmo13g04339 . 22 267 Chloroplast and Mitochondria gene family AT1G29930 89.879 2.71e-162 449.0
Chmo13g04340 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 5.86e-173 476.0
Chmo22g02557 CSH 1 187 Chloroplast and Mitochondria gene family AT1G17530 62.567 1.08e-73 218.0
Chmo7g04378 CSH 45 215 Chloroplast and Mitochondria gene family AT4G25570 69.591 2.42e-84 247.0
Chmo17g00991 CSH 5 354 Chloroplast and Mitochondria gene family AT5G54290 67.521 3.12e-146 415.0
Chmo2g00867 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 2.04e-163 460.0
Chmo2g00870 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 61.654 1.12e-98 286.0
Chmo2g00871 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.41e-167 462.0
Chmo16g03098 . 33 317 Chloroplast and Mitochondria gene family AT1G25380 66.319 2.12e-136 390.0
Chmo24g03000 CSH 93 271 Chloroplast and Mitochondria gene family AT4G03320 39.674 2.01e-42 144.0
Chmo27g02722 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 91.48 9.24e-152 422.0
Chmo27g02711 . 32 252 Chloroplast and Mitochondria gene family AT3G61470 91.403 6.66e-151 421.0
Chmo11g00110 . 168 270 Chloroplast and Mitochondria gene family AT5G01530 86.408 2.05e-57 177.0
Chmo11g00113 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 85.036 3.03e-164 456.0
Chmo7g02125 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.786 2.71e-47 159.0
Chmo22g00563 . 206 255 Chloroplast and Mitochondria gene family AT2G34430 88.0 3.99e-25 90.9
Chmo23g00872 . 1 364 Chloroplast and Mitochondria gene family AT5G14040 77.198 0.0 561.0
Chmo16g01071 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.98e-122 348.0
Chmo9g04239 CSH 180 304 Chloroplast and Mitochondria gene family AT2G47490 28.025 9.63e-06 43.5
Chmo8g04300 . 179 290 Chloroplast and Mitochondria gene family AT2G47490 26.389 4.36e-06 43.9
Chmo16g04057 . 1 265 Chloroplast and Mitochondria gene family AT1G29930 86.466 6.99e-167 460.0
Chmo20g01489 CSH 3 145 Chloroplast and Mitochondria gene family AT1G07020 50.685 1.12e-30 106.0
Chmo6g02044 CSH 1 315 Chloroplast and Mitochondria gene family AT5G15640 76.19 5.24e-180 499.0
Chmo7g02524 . 142 200 Chloroplast and Mitochondria gene family AT3G54890 58.333 2.12e-15 67.4
Chmo2g03199 ACH,CSH 4 271 Chloroplast and Mitochondria gene family AT2G30160 67.897 3.60e-123 353.0
Chmo3g01089 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 4.11e-167 461.0
Chmo3g01091 . 1 241 Chloroplast and Mitochondria gene family AT1G29930 74.689 3.39e-117 335.0
Chmo3g01088 . 221 265 Chloroplast and Mitochondria gene family AT2G05070 91.111 3.79e-25 92.0
Chmo3g01092 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 1.48e-168 464.0
Chmo7g02882 ACH,CSH 1 302 Chloroplast and Mitochondria gene family AT5G40810 84.59 2.55e-176 495.0
Chmo15g00593 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.109 2.86e-165 457.0
Chmo16g03519 CSH 72 404 Chloroplast and Mitochondria gene family AT2G28800 60.955 8.58e-147 435.0
Chmo27g00796 ACH,CSH 30 237 Chloroplast and Mitochondria gene family AT2G47490 36.866 2.62e-29 112.0
Chmo23g03883 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.5 2.69e-144 401.0
Chmo26g02252 . 17 305 Chloroplast and Mitochondria gene family AT2G17270 68.166 9.87e-158 441.0
Chmo6g02623 . 64 280 Chloroplast and Mitochondria gene family AT4G10340 77.869 6.58e-121 344.0
Chmo5g03197 . 38 251 Chloroplast and Mitochondria gene family AT3G61470 46.544 4.99e-62 194.0
Chmo6g02624 . 32 280 Chloroplast and Mitochondria gene family AT4G10340 87.6 5.05e-146 409.0
Chmo21g01991 . 94 216 Chloroplast and Mitochondria gene family AT1G29910 62.602 2.57e-43 141.0
Chmo21g01994 . 87 265 Chloroplast and Mitochondria gene family AT2G05070 81.564 8.60e-109 310.0
Chmo21g01993 . 1 257 Chloroplast and Mitochondria gene family AT1G29930 84.496 1.74e-155 432.0
Chmo27g01487 . 5 373 Chloroplast and Mitochondria gene family AT5G14040 77.838 0.0 576.0
Chmo27g01485 . 55 225 Chloroplast and Mitochondria gene family AT5G14040 56.725 5.72e-65 202.0
Chmo15g00814 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 4.51e-122 347.0
Chmo9g03337 CSH 19 228 Chloroplast and Mitochondria gene family AT5G38630 70.952 5.72e-111 315.0
Chmo26g00854 ACH,CSH 97 237 Chloroplast and Mitochondria gene family AT2G47490 35.57 6.70e-15 70.9
Chmo1g04265 . 2 308 Chloroplast and Mitochondria gene family AT2G47490 74.516 3.24e-158 442.0
Chmo10g03025 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 63.889 2.58e-31 102.0
Chmo9g04056 . 194 291 Chloroplast and Mitochondria gene family AT1G25380 33.673 1.75e-07 45.4
Chmo16g02234 . 68 225 Chloroplast and Mitochondria gene family AT3G61470 51.266 6.44e-53 167.0
Chmo24g00860 . 169 379 Chloroplast and Mitochondria gene family AT4G21490 70.755 3.85e-98 295.0
Chmo24g00829 . 1 364 Chloroplast and Mitochondria gene family AT5G14040 76.648 0.0 556.0
Chmo5g02038 ACH,CSH 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.936 0.0 503.0
Chmo4g03379 . 168 248 Chloroplast and Mitochondria gene family AT5G14040 77.778 2.49e-38 134.0
Chmo10g00070 . 28 97 Chloroplast and Mitochondria gene family AT2G05070 50.0 3.43e-18 77.8
Chmo10g00021 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.672 1.57e-163 454.0
Chmo17g01815 CSH 102 255 Chloroplast and Mitochondria gene family AT3G61470 51.299 1.45e-47 152.0
Chmo14g00710 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.5 7.94e-166 458.0
Chmo13g01945 . 132 266 Chloroplast and Mitochondria gene family AT2G34430 89.63 9.81e-84 246.0
Chmo9g00003 . 79 150 Chloroplast and Mitochondria gene family AT1G76570 54.167 7.17e-24 89.7
Chmo9g01955 CSH 33 303 Chloroplast and Mitochondria gene family AT1G25380 27.181 6.83e-13 66.6
Chmo24g03857 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.5 2.69e-144 401.0
Chmo20g03235 . 206 303 Chloroplast and Mitochondria gene family AT2G28800 78.571 1.01e-51 167.0
Chmo11g01246 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 2.37e-168 464.0
Chmo17g03026 CSH 55 223 Chloroplast and Mitochondria gene family AT1G14730 59.763 1.80e-65 200.0
Chmo17g03027 CSH 5 208 Chloroplast and Mitochondria gene family AT4G25570 43.204 1.10e-55 176.0
Chmo8g01980 CSH 33 303 Chloroplast and Mitochondria gene family AT1G25380 28.904 3.35e-13 67.8
Chmo7g03193 CSH 1 228 Chloroplast and Mitochondria gene family AT5G38630 69.298 1.43e-117 333.0
Chmo17g04249 . 168 264 Chloroplast and Mitochondria gene family AT2G34430 92.784 2.35e-58 178.0
Chmo17g04248 . 1 134 Chloroplast and Mitochondria gene family AT1G29930 80.741 1.06e-75 224.0
Chmo26g01207 ACH,CSH 2 228 Chloroplast and Mitochondria gene family AT5G38630 65.789 2.60e-108 309.0
Chmo27g02056 . 17 305 Chloroplast and Mitochondria gene family AT2G17270 68.512 2.67e-157 439.0
Chmo16g01078 CSH 5 354 Chloroplast and Mitochondria gene family AT5G54290 67.123 2.31e-147 418.0
Chmo25g02058 . 17 305 Chloroplast and Mitochondria gene family AT2G17270 68.166 4.47e-157 439.0
Chmo9g00033 . 103 327 Chloroplast and Mitochondria gene family AT1G76570 82.222 9.04e-143 400.0
Chmo26g01899 ACH,CSH 33 318 Chloroplast and Mitochondria gene family AT1G25380 57.191 5.15e-112 327.0
Chmoscaffold_8704__frag0ment_1g00003 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.434 1.71e-180 494.0
Chmoscaffold_8704__frag0ment_1g00002 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 87.547 7.27e-178 488.0
Chmoscaffold_8704__frag0ment_1g00001 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 87.925 1.42e-178 490.0
Chmo17g02042 . 84 255 Chloroplast and Mitochondria gene family AT3G61470 51.744 5.72e-57 178.0
Chmo19g02378 CSH 81 265 Chloroplast and Mitochondria gene family AT2G05070 78.919 3.86e-109 311.0
Chmo19g02377 . 1 257 Chloroplast and Mitochondria gene family AT1G29930 81.008 3.28e-147 410.0
Chmo25g01736 ACH,CSH 33 229 Chloroplast and Mitochondria gene family AT1G25380 59.33 1.05e-77 236.0
Chmo4g03261 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 86.38 2.86e-156 435.0
Chmo4g03262 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 80.714 2.53e-146 409.0
Chmo21g03909 . 223 265 Chloroplast and Mitochondria gene family AT2G34430 74.419 7.47e-17 70.5
Chmo21g03975 . 297 411 Chloroplast and Mitochondria gene family AT4G21490 66.379 9.33e-51 167.0
Chmo18g03203 CSH 72 404 Chloroplast and Mitochondria gene family AT2G28800 61.236 1.99e-151 440.0
Chmo4g02169 ACH,CSH 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.936 0.0 503.0
Chmo4g03777 . 38 255 Chloroplast and Mitochondria gene family AT3G61470 52.752 2.74e-75 227.0
Chmoscaffold_8050__frag0ment_1g00003 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.435 7.41e-167 467.0
Chmo13g02425 CSH 66 548 Chloroplast and Mitochondria gene family AT2G18710 85.093 0.0 835.0
Chmo23g04510 . 229 278 Chloroplast and Mitochondria gene family AT1G76570 86.0 1.18e-22 97.4
Chmo13g03132 . 55 257 Chloroplast and Mitochondria gene family AT3G61470 66.995 2.31e-99 286.0
Chmo7g01683 CSH 33 298 Chloroplast and Mitochondria gene family AT1G25380 28.819 2.07e-13 68.6
Chmo25g02367 . 31 548 Chloroplast and Mitochondria gene family AT4G21490 68.522 0.0 726.0
Chmo24g02915 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 5.41e-167 461.0
Chmo24g02922 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 1.91e-165 457.0
Chmo24g02914 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 86.641 2.34e-164 454.0
Chmo24g02925 . 6 121 Chloroplast and Mitochondria gene family AT1G29930 67.241 1.21e-47 152.0
Chmo24g02919 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 74.157 1.93e-130 367.0
Chmo24g02909 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 2.58e-167 461.0
Chmo24g02920 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.393 1.00e-164 455.0
Chmo24g02923 . 171 266 Chloroplast and Mitochondria gene family AT3G27690 82.292 4.90e-55 172.0
Chmo24g02924 . 93 266 Chloroplast and Mitochondria gene family AT2G34430 78.736 3.54e-89 259.0
Chmo24g02907 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 1.90e-168 464.0
Chmo24g02913 . 1 161 Chloroplast and Mitochondria gene family AT1G29930 82.609 2.68e-92 267.0
Chmo24g02917 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 75.191 4.42e-137 384.0
Chmo24g02921 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 2.02e-166 459.0
Chmo24g02918 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 85.714 7.72e-169 465.0
Chmo24g02911 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.393 4.28e-168 463.0
Chmo24g02908 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 3.71e-171 471.0
Chmo24g02910 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 86.26 6.77e-167 460.0
Chmo24g02912 . 168 266 Chloroplast and Mitochondria gene family AT2G34430 91.919 3.18e-59 180.0
Chmo24g02916 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 77.528 5.99e-142 396.0
Chmo16g02456 CSH 37 323 Chloroplast and Mitochondria gene family AT1G07030 31.488 4.97e-32 120.0
Chmo6g03521 . 5 367 Chloroplast and Mitochondria gene family AT5G14040 68.871 4.18e-179 499.0
Chmo8g01056 . 210 404 Chloroplast and Mitochondria gene family AT2G28800 54.245 2.35e-70 223.0
Chmo17g02350 CSH 12 312 Chloroplast and Mitochondria gene family AT2G47490 28.045 1.78e-28 110.0
Chmo17g01129 . 1 369 Chloroplast and Mitochondria gene family AT5G14040 71.545 0.0 544.0
Chmo8g00754 . 79 212 Chloroplast and Mitochondria gene family AT1G76570 66.418 1.74e-64 197.0
Chmo17g02774 . 109 208 Chloroplast and Mitochondria gene family AT3G27240 89.0 1.21e-51 163.0
Chmo21g02339 . 65 255 Chloroplast and Mitochondria gene family AT3G61470 53.927 1.03e-66 203.0
Chmo26g02667 . 158 252 Chloroplast and Mitochondria gene family AT3G61470 84.375 2.25e-51 160.0
Chmo26g02669 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 91.031 6.15e-151 420.0
Chmo9g04606 CSH 1 215 Chloroplast and Mitochondria gene family AT4G25570 68.519 1.45e-105 303.0
Chmo16g03139 . 326 433 Chloroplast and Mitochondria gene family AT4G21490 35.537 2.95e-15 73.6
Chmo9g03059 ACH,CSH 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.174 0.0 508.0
Chmo3g03703 ACH,CSH 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 2.23e-35 112.0
Chmo27g01641 . 9 236 Chloroplast and Mitochondria gene family AT1G26100 65.823 4.68e-97 283.0
Chmo14g02311 CSH 68 548 Chloroplast and Mitochondria gene family AT2G18710 85.239 0.0 833.0
Chmo7g03124 . 154 194 Chloroplast and Mitochondria gene family AT3G54890 78.571 3.83e-14 63.9
Chmo26g03629 . 109 276 Chloroplast and Mitochondria gene family AT5G40810 85.714 2.21e-94 274.0
Chmo7g00026 . 27 325 Chloroplast and Mitochondria gene family AT1G76570 74.582 3.55e-172 479.0
Chmo17g00981 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.98e-122 348.0
Chmo8g02439 ACH 29 264 Chloroplast and Mitochondria gene family AT2G47490 34.836 9.69e-35 125.0
Chmo20g02424 . 225 257 Chloroplast and Mitochondria gene family AT3G61470 57.576 9.98e-07 47.0
Chmo20g01791 . 1 257 Chloroplast and Mitochondria gene family AT1G29930 75.969 1.51e-135 380.0
Chmo20g02167 . 108 255 Chloroplast and Mitochondria gene family AT3G61470 50.676 6.54e-45 145.0
Chmo20g01792 CSH 105 265 Chloroplast and Mitochondria gene family AT2G34420 73.292 3.55e-79 233.0
Chmo15g02523 CSH 68 548 Chloroplast and Mitochondria gene family AT2G18710 85.239 0.0 833.0
Chmo18g02597 CSH 8 223 Chloroplast and Mitochondria gene family AT1G14730 59.259 2.94e-87 255.0
Chmo18g02739 ACH,CSH 33 317 Chloroplast and Mitochondria gene family AT1G25380 66.319 1.82e-136 390.0
Chmo18g01429 . 34 255 Chloroplast and Mitochondria gene family AT3G61470 51.802 4.89e-73 221.0
Chmo18g02109 CSH 12 312 Chloroplast and Mitochondria gene family AT2G47490 28.045 1.78e-28 110.0
Chmo6g01017 CSH 29 300 Chloroplast and Mitochondria gene family AT4G25700 70.652 6.04e-144 405.0