AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cich4g04664 ATGGCCGCAGCTGCTAGCTCCACTACCGTGGTCCGAGCCACCCCATTCTTGGGTCAAACCAGACCATCGAGTCTCAACCCTCTAAGAGATGTTGTCTCTATGCCCAGTGCCAAATTCACCATGGGAAATGATTTGTGGTATGGACCTGACCGTGTCAAATACTTGGGACCCTTTTCGGCTCAGACCCCATCGTACTTAACTGGAGAATTCCCCGGCGACTACGGTTGGGATACCGCCGGCTTGTCCGCTGATCCCGAGGCCTTCGCCAAGAACAGAGCTCTTGAGGTTATCCATGGGCGATGGGCCATGCTTGGTGCATTCGGTTGCATCACACCCGAGGTTCTTGAAAAGTGGGTGAAAGTGGATTTCAAGGAGCCAGTTTGGTTCAAGGCCGGAGCCCAGATTTTCTCCGAAGGTGGTCTGGACTACTTAGGGAACCCAAACCTTGTTCATGCTCAAAGCATACTGGCGGTTCTCGGATTCCAAGTGGTGTTGATGGGTCTTGTGGAGGGGTTCCGCATTAACGGTCTTGAAGGTGTTGGAGAAGGTAACAACTTGTACCCGGGTGGACAATATTTTGACCCGTTGGGGCTTGCAGATGACCCGGTGACATTTGCTGAGTTGAAGGTGAAGGAGATCAAGAATGGAAGGCTGGCAATGTTTTCCATGTTTGGGTTTTTTGTGCAAGCGATTGTTACAGGGAAAGGTCCATTGGAGAACCTGTTGGACCATTTGGACAACCCTGTGGCTAACAATGCTTGGGTCTATGCCACCAAGTTTGTGCCCGGTTCATAG 795 51.57 MAAAASSTTVVRATPFLGQTRPSSLNPLRDVVSMPSAKFTMGNDLWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGAFGCITPEVLEKWVKVDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLEGVGEGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGS 264
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Cich4g04664 264 SUPERFAMILY Chlorophyll a-b binding protein 45 261 - -
Cich4g04664 264 FunFam Chlorophyll a-b binding protein, chloroplastic 53 257 - -
Cich4g04664 264 Pfam Chlorophyll A-B binding protein 63 231 IPR022796 -
Cich4g04664 264 Gene3D Chlorophyll a-b binding protein domain 53 257 - -
Cich4g04664 264 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 28 263 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cich4g04664 K08914 light-harvesting complex II chlorophyll a/b binding protein 3
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
63054 Cich4g04664 Cich9g00135
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Cich Cich-Chr4:134199849 Cich7g02026 Cich-Chr7:83222959 dispersed
Cich Cich-Chr4:129658465 Cich4g04664 Cich-Chr4:134199849 transposed
Cich Cich-Chr3:78125544 Cich4g04664 Cich-Chr4:134199849 transposed
Cich Cich-Chr6:12757103 Cich4g04664 Cich-Chr4:134199849 transposed
Cich Cich-Chr4:134199849 Cich9g00135 Cich-Chr9:3682162 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cich9g00135 ACH 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 6.06e-123 350.0
Cich9g00875 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 32.857 3.08e-34 125.0
Cich9g00949 . 349 382 Chloroplast and Mitochondria gene family AT2G18710 79.412 3.27e-11 63.2
Cich8g00297 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 91.031 3.93e-151 421.0
Cich8g00844 ACH 10 257 Chloroplast and Mitochondria gene family AT1G25380 68.127 2.19e-110 320.0
Cich8g00901 . 1 236 Chloroplast and Mitochondria gene family AT1G26100 63.673 2.71e-95 277.0
Cich8g01733 ACH 2 372 Chloroplast and Mitochondria gene family AT5G14040 78.167 0.0 576.0
Cich8g02307 . 1 76 Chloroplast and Mitochondria gene family AT1G15820 52.632 5.60e-19 77.4
Cich7g00420 . 1 106 Chloroplast and Mitochondria gene family AT2G05100 78.302 5.00e-58 180.0
Cich7g01220 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.696 3.32e-160 450.0
Cich7g02026 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.39 2.34e-174 479.0
Cich6g00194 . 1 217 Chloroplast and Mitochondria gene family AT4G25570 69.124 2.68e-107 307.0
Cich6g00606 . 37 316 Chloroplast and Mitochondria gene family AT1G25380 26.452 9.77e-30 114.0
Cich6g00902 . 100 239 Chloroplast and Mitochondria gene family AT3G54890 63.83 1.29e-50 160.0
Cich6g01352 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 7.22e-173 476.0
Cich6g01679 ACH 2 369 Chloroplast and Mitochondria gene family AT5G14040 77.446 0.0 573.0
Cich6g01743 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.161 0.0 510.0
Cich6g01745 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.161 0.0 505.0
Cich6g02048 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 71.053 2.18e-119 337.0
Cich6g04249 . 43 327 Chloroplast and Mitochondria gene family AT1G76570 78.596 1.53e-173 482.0
Cich5g00957 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 75.068 0.0 553.0
Cich5g02188 . 106 314 Chloroplast and Mitochondria gene family AT5G14040 60.748 2.87e-83 252.0
Cich5g02275 . 349 379 Chloroplast and Mitochondria gene family AT2G18710 77.419 1.82e-11 56.2
Cich5g02599 . 162 288 Chloroplast and Mitochondria gene family AT5G14040 74.803 3.49e-62 194.0
Cich5g03672 . 78 152 Chloroplast and Mitochondria gene family AT5G15640 60.526 3.43e-24 94.0
Cich5g03880 . 162 225 Chloroplast and Mitochondria gene family AT5G14040 73.438 6.83e-26 99.0
Cich4g00025 . 1 305 Chloroplast and Mitochondria gene family AT2G47490 75.817 7.87e-164 456.0
Cich4g00112 . 78 156 Chloroplast and Mitochondria gene family AT5G15640 50.0 4.68e-15 70.9
Cich4g00646 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 70.833 4.55e-36 114.0
Cich4g01353 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.672 4.18e-163 452.0
Cich4g01354 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 85.401 2.82e-164 456.0
Cich4g01751 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 2.60e-169 466.0
Cich4g01960 . 17 300 Chloroplast and Mitochondria gene family AT4G25700 66.452 4.19e-148 417.0
Cich4g02143 . 211 310 Chloroplast and Mitochondria gene family AT1G25380 30.392 6.68e-10 57.8
Cich4g03488 . 239 368 Chloroplast and Mitochondria gene family AT5G14040 75.385 3.22e-63 198.0
Cich4g03669 . 43 162 Chloroplast and Mitochondria gene family AT2G30160 29.839 2.04e-06 47.4
Cich4g04435 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 89.453 1.91e-173 479.0
Cich4g04664 ACH 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.91 7.84e-122 346.0
Cich3g00418 . 179 265 Chloroplast and Mitochondria gene family AT1G72820 66.292 4.72e-34 123.0
Cich3g00581 ACH 15 224 Chloroplast and Mitochondria gene family AT5G38630 42.857 2.91e-57 179.0
Cich3g00777 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 1.56e-173 477.0
Cich3g00778 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 1.16e-173 478.0
Cich3g01056 . 100 258 Chloroplast and Mitochondria gene family AT1G07030 63.125 6.53e-56 177.0
Cich3g01664 ACH 55 393 Chloroplast and Mitochondria gene family AT4G21490 40.698 5.42e-70 233.0
Cich3g02637 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 71.978 0.0 532.0
Cich3g02978 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 69.972 1.03e-174 487.0
Cich3g02992 ACH 2 188 Chloroplast and Mitochondria gene family AT1G72750 62.032 3.58e-72 214.0
Cich3g03271 . 5 307 Chloroplast and Mitochondria gene family AT5G40810 82.051 1.80e-172 479.0
Cich3g03411 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.224 9.46e-74 223.0
Cich3g03956 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 48.077 3.48e-61 192.0
Cich3g04101 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 85.0 3.46e-156 435.0
Cich3g04103 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.214 1.60e-153 428.0
Cich2g00805 ACH 4 214 Chloroplast and Mitochondria gene family AT4G25570 47.867 2.58e-64 197.0
Cich2g01043 ACH 33 317 Chloroplast and Mitochondria gene family AT1G25380 69.097 9.69e-143 407.0
Cich2g01049 . 215 317 Chloroplast and Mitochondria gene family AT1G25380 54.369 3.51e-35 125.0
Cich2g01236 . 110 223 Chloroplast and Mitochondria gene family AT1G15820 82.456 1.84e-63 192.0
Cich2g02060 . 49 407 Chloroplast and Mitochondria gene family AT2G28800 57.841 1.34e-148 432.0
Cich2g02593 . 182 356 Chloroplast and Mitochondria gene family AT5G14040 64.062 3.01e-74 234.0
Cich2g03410 . 5 143 Chloroplast and Mitochondria gene family AT1G07020 45.033 2.40e-27 98.2
Cich2g03411 . 1 320 Chloroplast and Mitochondria gene family AT1G07030 70.769 7.20e-159 445.0
Cich2g03728 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 66.667 4.99e-152 432.0
Cich2g03752 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 1.99e-33 107.0
Cich2g04199 . 65 548 Chloroplast and Mitochondria gene family AT2G18710 84.298 0.0 828.0
Cich2g04790 . 349 379 Chloroplast and Mitochondria gene family AT2G18710 80.645 7.59e-10 58.9
Cich2g04803 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 68.116 2.72e-102 297.0
Cich2g04981 . 212 305 Chloroplast and Mitochondria gene family AT1G72820 54.255 8.47e-26 96.7
Cich1g00331 ACH 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.646 2.20e-168 469.0
Cich1g00425 . 51 447 Chloroplast and Mitochondria gene family AT2G28800 75.931 0.0 599.0
Cich1g00845 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 27.273 3.88e-31 119.0
Cich1g01340 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.62 1.55e-147 411.0
Cich1g01635 . 196 356 Chloroplast and Mitochondria gene family AT5G14040 68.944 1.36e-68 214.0
Cich1g02139 ACH 4 187 Chloroplast and Mitochondria gene family AT1G17530 63.043 1.41e-74 221.0
Cich1g02465 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 8.80e-172 473.0
Cich1g02466 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.44e-172 475.0
Cich1g02935 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.845 1.85e-168 471.0
Cich1g03530 . 32 119 Chloroplast and Mitochondria gene family AT5G15640 45.455 2.96e-16 72.4
Cich1g04756 . 9 316 Chloroplast and Mitochondria gene family AT1G07030 30.599 1.16e-32 125.0
Cich1g05237 . 136 213 Chloroplast and Mitochondria gene family AT1G72820 54.43 5.78e-24 92.4