AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cind3g02834 ATGGCAACACAAGCTTTGGTCTCATCATCATCACTCACATCCTCAGTTGAGTCTGCTAGACAAATCCTTGGTGCAAGACCAGCTTTCACACCAACAAGAAAAGTTTCATTTGTTGTCAAAGCTGCTTCCACCCCTCCTGTTAAGCAAGGAGACAGACAACTATGGTTTGCATCCAAGCAATCTCTTTCTTACCTGGATGGAACTCTCCCAGGTGACTTTGGATTCGACCCACTTGGTCTTTCCGACCCAGAAGGGACCGGAGGATTCATCGAACCCAAGTGGCTAGCTTACGGAGAGGTTATCAATGGACGGTTTGCCATGTTGGGTGCGGCCGGAGCTATTGCACCTGAAATTTTTGGCAAGCTTGGACTCATCCCAGCCGAAACTGCCCTTCCATGGTTCAAGACCGGTGTCATCCCCCCAGCCGGCACATACAACTACTGGGCTGACCCTTTCACCCTATTTGTATTTGAAATGGCACTTATGGGCTTTGCAGAACACAGAAGACTACAAGATTGGTACAACCCAGGATCAATGGGAAAACAATACTTTTTGGGTTTAGAAAAAGGTTTTTCAGGGTCGGGCGACCCAGCATACCCAGGTGGCCCGTTCTTTAACCCTCTTGGGTTTGGGAAAGATGAGAAGTCAATGAAGGAATTGAAGCTAAAAGAGATCAAGAACGGTAGATTGGCTATGTTGGCTATCTTAGGTTACTTCATTCAGGGTTTGGTGACTGGGGTTGGACCTTTTCAGAACCTTTTGGATCATTTGGCTGATCCTGTCAACAACAATGTCTTGACCAGCCTTAAGTTCCACTAG 819 47.13 MATQALVSSSSLTSSVESARQILGARPAFTPTRKVSFVVKAASTPPVKQGDRQLWFASKQSLSYLDGTLPGDFGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEIFGKLGLIPAETALPWFKTGVIPPAGTYNYWADPFTLFVFEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 272
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Cind3g02834 272 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 4 267 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Cind3g02834 272 Pfam Chlorophyll A-B binding protein 63 242 IPR022796 -
Cind3g02834 272 FunFam Chlorophyll a-b binding protein, chloroplastic 53 271 - -
Cind3g02834 272 SUPERFAMILY Chlorophyll a-b binding protein 51 268 - -
Cind3g02834 272 Gene3D Chlorophyll a-b binding protein domain 53 271 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cind3g02834 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Cind Cind-Chr3:338504902 Cind4g04861 Cind-Chr4:265019047 dispersed
Cind Cind-Chr3:338504902 Cind1g03331 Cind-Chr1:357653094 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cind1g00247 . 10 187 Chloroplast and Mitochondria gene family AT1G17530 64.045 8.15e-73 216.0
Cind1g00305 . 7 239 Chloroplast and Mitochondria gene family AT3G54890 82.479 2.52e-140 391.0
Cind1g00362 . 7 239 Chloroplast and Mitochondria gene family AT3G54890 73.077 5.84e-118 333.0
Cind1g01615 . 234 436 Chloroplast and Mitochondria gene family AT4G21490 58.333 6.66e-72 238.0
Cind1g01876 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 77.198 0.0 561.0
Cind1g02322 . 123 266 Chloroplast and Mitochondria gene family AT2G34430 83.333 8.35e-81 239.0
Cind1g02128 . 194 291 Chloroplast and Mitochondria gene family AT1G25380 32.653 7.47e-07 43.5
Cind1g02677 . 109 209 Chloroplast and Mitochondria gene family AT3G27240 87.129 3.77e-51 165.0
Cind1g03331 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 85.766 1.24e-159 474.0
Cind1g03420 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 2.83e-179 491.0
Cind1g03421 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 76.604 3.99e-147 409.0
Cind1g03422 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 7.93e-179 491.0
Cind1g03423 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.811 0.0 497.0
Cind1g03791 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.008 4.39e-149 415.0
Cind1g03851 . 41 81 Chloroplast and Mitochondria gene family AT3G61470 60.976 7.58e-08 50.8
Cind1g04175 . 116 208 Chloroplast and Mitochondria gene family AT1G29930 70.968 1.31e-36 124.0
Cind1g05417 . 18 316 Chloroplast and Mitochondria gene family AT1G07030 28.387 3.89e-31 121.0
Cind1g06633 . 47 267 Chloroplast and Mitochondria gene family AT1G29930 92.76 9.60e-151 419.0
Cind1g06634 . 81 208 Chloroplast and Mitochondria gene family AT1G29910 88.281 1.04e-77 231.0
Cind1g06635 . 50 267 Chloroplast and Mitochondria gene family AT1G29930 93.119 2.53e-150 418.0
Cind1g06636 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 83.895 3.06e-162 448.0
Cind1g06637 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 85.714 7.72e-169 465.0
Cind1g06639 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 4.30e-166 458.0
Cind1g06640 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 6.24e-168 463.0
Cind1g06641 . 7 140 Chloroplast and Mitochondria gene family AT1G29930 79.104 3.11e-72 217.0
Cind1g06686 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 1.72e-168 464.0
Cind1g06687 . 1 88 Chloroplast and Mitochondria gene family AT1G29930 75.0 1.07e-37 125.0
Cind1g06688 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 6.24e-168 463.0
Cind1g06689 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 3.41e-166 459.0
Cind1g06690 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 1.33e-169 467.0
Cind1g06691 . 199 266 Chloroplast and Mitochondria gene family AT2G34430 94.118 1.42e-39 134.0
Cind1g07293 . 93 271 Chloroplast and Mitochondria gene family AT4G03320 39.674 1.30e-42 144.0
Cind1g07616 . 93 271 Chloroplast and Mitochondria gene family AT4G03320 39.13 5.40e-42 142.0
Cind1g07639 . 1 31 Chloroplast and Mitochondria gene family AT1G72820 77.419 4.90e-12 58.5
Cind1g07665 ACH 314 354 Chloroplast and Mitochondria gene family AT5G54290 73.171 3.54e-07 46.6
Cind2g01067 . 72 403 Chloroplast and Mitochondria gene family AT2G28800 61.08 6.79e-149 433.0
Cind2g01126 ACH 33 317 Chloroplast and Mitochondria gene family AT1G25380 66.319 1.68e-136 390.0
Cind2g01136 . 90 277 Chloroplast and Mitochondria gene family AT1G76570 77.368 1.08e-106 312.0
Cind2g01198 . 208 238 Chloroplast and Mitochondria gene family AT5G14040 74.194 2.75e-10 53.9
Cind2g02024 ACH 1 369 Chloroplast and Mitochondria gene family AT5G14040 71.545 0.0 546.0
Cind2g02872 . 8 218 Chloroplast and Mitochondria gene family AT1G14730 59.242 5.47e-82 248.0
Cind2g02984 . 12 312 Chloroplast and Mitochondria gene family AT2G47490 26.398 3.10e-18 81.6
Cind2g03104 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 2.46e-173 477.0
Cind2g03173 . 120 404 Chloroplast and Mitochondria gene family AT2G28800 65.574 1.15e-142 413.0
Cind2g03760 . 217 257 Chloroplast and Mitochondria gene family AT3G61470 58.537 1.42e-10 54.7
Cind2g03761 . 142 197 Chloroplast and Mitochondria gene family AT3G54890 58.929 4.77e-16 68.2
Cind2g04346 . 102 255 Chloroplast and Mitochondria gene family AT3G61470 51.299 1.16e-46 150.0
Cind2g04857 . 135 228 Chloroplast and Mitochondria gene family AT5G38630 67.021 1.02e-40 139.0
Cind2g05736 . 34 255 Chloroplast and Mitochondria gene family AT3G61470 45.045 2.41e-55 175.0
Cind2g06249 . 250 315 Chloroplast and Mitochondria gene family AT5G14040 51.515 9.62e-15 65.1
Cind2g06191 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.98e-122 348.0
Cind2g06201 . 5 354 Chloroplast and Mitochondria gene family AT5G54290 68.079 6.55e-146 414.0
Cind2g06374 . 206 289 Chloroplast and Mitochondria gene family AT2G28800 82.143 1.12e-41 152.0
Cind3g00652 . 66 548 Chloroplast and Mitochondria gene family AT2G18710 84.886 0.0 834.0
Cind3g01867 . 71 266 Chloroplast and Mitochondria gene family AT2G34430 63.776 3.35e-79 242.0
Cind3g02834 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.5 4.44e-166 459.0
Cind3g03140 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 66.667 2.43e-102 297.0
Cind3g03592 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 1.68e-172 474.0
Cind3g03593 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 1.68e-172 474.0
Cind3g03595 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 7.30e-172 473.0
Cind3g03596 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 1.68e-172 474.0
Cind3g03597 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 2.16e-171 472.0
Cind3g03598 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 9.09e-172 473.0
Cind3g05191 . 158 200 Chloroplast and Mitochondria gene family AT3G54890 72.093 2.09e-15 68.2
Cind3g05298 . 223 266 Chloroplast and Mitochondria gene family AT2G34430 81.818 3.61e-20 80.9
Cind3g05438 . 109 211 Chloroplast and Mitochondria gene family AT3G27240 85.437 1.73e-53 167.0
Cind3g05724 . 109 211 Chloroplast and Mitochondria gene family AT3G27240 83.495 5.73e-50 158.0
Cind3g05615 . 2 160 Chloroplast and Mitochondria gene family AT2G05070 64.596 5.74e-67 203.0
Cind3g05616 . 191 265 Chloroplast and Mitochondria gene family AT2G05100 77.333 7.09e-38 125.0
Cind4g00949 . 1 320 Chloroplast and Mitochondria gene family AT5G15640 70.0 2.66e-161 450.0
Cind4g01568 ACH 109 187 Chloroplast and Mitochondria gene family AT3G27240 83.544 1.14e-31 112.0
Cind4g02352 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.435 5.49e-157 468.0
Cind4g02443 . 38 255 Chloroplast and Mitochondria gene family AT3G61470 52.752 1.76e-75 228.0
Cind4g02607 ACH 90 307 Chloroplast and Mitochondria gene family AT5G40810 93.119 5.34e-138 387.0
Cind4g03185 . 55 367 Chloroplast and Mitochondria gene family AT5G14040 75.719 1.04e-177 496.0
Cind4g03972 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 86.38 2.86e-156 435.0
Cind4g03973 . 32 280 Chloroplast and Mitochondria gene family AT4G10340 87.6 5.05e-146 409.0
Cind4g04861 . 37 251 Chloroplast and Mitochondria gene family AT3G61470 47.248 5.60e-63 197.0
Cind4g04080 . 132 343 Chloroplast and Mitochondria gene family AT1G72820 71.163 5.15e-111 320.0
Cind4g04081 . 1 102 Chloroplast and Mitochondria gene family AT1G72820 61.538 7.43e-40 133.0
Cind4g05583 . 29 300 Chloroplast and Mitochondria gene family AT4G25700 70.652 5.69e-145 408.0
Cind5g01274 . 84 208 Chloroplast and Mitochondria gene family AT1G29910 49.6 3.17e-26 95.9
Cind5g03034 . 109 209 Chloroplast and Mitochondria gene family AT3G27240 88.119 1.61e-50 164.0
Cind5g03244 . 223 266 Chloroplast and Mitochondria gene family AT2G34430 77.273 5.12e-18 75.5
Cind5g01868 . 238 278 Chloroplast and Mitochondria gene family AT1G76570 73.171 1.79e-16 70.9
Cind5g03682 . 93 214 Chloroplast and Mitochondria gene family AT2G05070 55.738 3.30e-38 129.0
Cind5g03684 . 1 95 Chloroplast and Mitochondria gene family AT1G29930 53.684 3.13e-24 90.5
Cind5g03685 . 105 265 Chloroplast and Mitochondria gene family AT2G34420 90.683 1.64e-102 293.0
Cind5g03686 . 105 248 Chloroplast and Mitochondria gene family AT2G34420 83.333 4.07e-82 242.0
Cind5g03808 . 3 145 Chloroplast and Mitochondria gene family AT1G07020 50.685 1.03e-30 106.0
Cind5g04368 . 79 247 Chloroplast and Mitochondria gene family AT1G76570 71.006 1.39e-87 258.0
Cind5g04369 . 288 325 Chloroplast and Mitochondria gene family AT1G76570 68.421 1.90e-14 65.5
Cind5g05581 . 48 164 Chloroplast and Mitochondria gene family AT2G17270 65.812 6.64e-51 168.0
Cind5g05733 . 48 164 Chloroplast and Mitochondria gene family AT2G17270 65.812 2.38e-51 169.0
Cind6g00434 . 136 167 Chloroplast and Mitochondria gene family AT3G27240 87.5 1.64e-12 63.9
Cind6g01599 . 55 236 Chloroplast and Mitochondria gene family AT1G29910 72.527 9.67e-86 253.0
Cind6g01672 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.672 1.19e-163 454.0
Cind6g01983 . 244 318 Chloroplast and Mitochondria gene family AT5G14040 52.0 1.95e-17 74.7
Cind6g02034 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 65.278 1.53e-31 103.0
Cind6g03371 . 5 215 Chloroplast and Mitochondria gene family AT4G25570 41.232 1.44e-54 172.0
Cind7g00547 . 208 291 Chloroplast and Mitochondria gene family AT2G28800 80.952 2.96e-43 144.0
Cind7g00652 . 27 325 Chloroplast and Mitochondria gene family AT1G76570 74.916 4.04e-172 478.0
Cind7g00653 . 42 255 Chloroplast and Mitochondria gene family AT1G76570 77.103 2.95e-125 359.0
Cind7g01844 . 154 195 Chloroplast and Mitochondria gene family AT3G54890 73.81 1.55e-15 71.6
Cind7g02324 . 154 194 Chloroplast and Mitochondria gene family AT3G54890 73.171 4.41e-14 67.8
Cind7g02389 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 78.387 1.60e-158 442.0
Cind7g02499 . 71 271 Chloroplast and Mitochondria gene family AT2G47490 34.928 5.16e-31 114.0
Cind7g03309 . 35 136 Chloroplast and Mitochondria gene family AT1G29930 86.275 3.72e-60 183.0
Cind7g03314 . 2 304 Chloroplast and Mitochondria gene family AT2G17270 66.447 2.92e-151 425.0
Cind7g03770 . 96 187 Chloroplast and Mitochondria gene family AT1G17530 60.87 1.42e-24 90.5
Cind7g04120 . 33 304 Chloroplast and Mitochondria gene family AT2G47490 29.153 3.61e-29 112.0
Cind7g04342 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 68.86 8.42e-115 338.0
Cind7g04766 ACH 54 372 Chloroplast and Mitochondria gene family AT5G14040 81.818 0.0 536.0
Cind7g05089 . 1 215 Chloroplast and Mitochondria gene family AT4G25570 68.981 3.06e-106 304.0
Cind8g00322 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.609 4.71e-150 425.0
Cind8g00903 . 2 308 Chloroplast and Mitochondria gene family AT2G47490 74.839 9.94e-159 444.0
Cind8g00927 . 2 308 Chloroplast and Mitochondria gene family AT2G47490 74.516 4.50e-158 442.0
Cind8g00965 . 43 445 Chloroplast and Mitochondria gene family AT2G28800 73.986 0.0 600.0
Cind8g01437 . 16 187 Chloroplast and Mitochondria gene family AT1G17530 65.698 3.27e-72 214.0
Cind8g01526 . 24 345 Chloroplast and Mitochondria gene family AT1G72820 65.839 2.38e-141 401.0
Cind8g01831 . 3 327 Chloroplast and Mitochondria gene family AT2G30160 69.091 1.44e-157 442.0
Cind8g02683 . 220 283 Chloroplast and Mitochondria gene family AT5G14040 70.312 2.76e-26 96.7
Cind8g02837 . 72 135 Chloroplast and Mitochondria gene family AT2G17270 60.938 2.37e-23 89.0
Cind8g03446 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 35.54 7.45e-43 148.0
Cind9g00552 ACH 33 177 Chloroplast and Mitochondria gene family AT1G25380 68.919 8.32e-63 197.0
Cind9g00554 ACH 33 282 Chloroplast and Mitochondria gene family AT1G25380 67.589 8.34e-123 353.0
Cind9g00718 . 187 303 Chloroplast and Mitochondria gene family AT1G25380 35.484 3.47e-17 76.3
Cind9g02494 . 9 236 Chloroplast and Mitochondria gene family AT1G26100 65.823 1.40e-97 283.0
Cind9g03500 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 91.48 9.24e-152 422.0
Cind9g03642 ACH 5 373 Chloroplast and Mitochondria gene family AT5G14040 78.976 0.0 577.0
Cind9g03647 . 54 225 Chloroplast and Mitochondria gene family AT5G14040 56.977 7.53e-63 202.0
Cind9g03648 . 244 364 Chloroplast and Mitochondria gene family AT5G14040 42.742 3.05e-17 79.3
Cind9g04225 ACH 109 205 Chloroplast and Mitochondria gene family AT5G40810 84.536 8.43e-47 150.0
Cind9g04366 . 344 431 Chloroplast and Mitochondria gene family AT4G21490 67.045 8.77e-40 136.0
Cind9g04379 . 3 228 Chloroplast and Mitochondria gene family AT5G38630 66.96 1.32e-108 311.0