AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cobi2g02264 ATGGCCACCGATGCATACGCCCCTACTTCCTTCCCAATTCTCTGTAACGCCGCTGCTGGTGCTTCCGCTGGAGTTATTGCAGCTACATTTGTGTGTCCTTTAGATGTCATCAAAACCAGGTTTCAGGTTCATGGACTTCCACAGCTTAACGGCGGAACCGTCAGAGGTAGTCTTATAATAGGTAGTCTAGAACAGATTTTCCGCAAGGAAGGGACGCGTGGTTTGTACCGTGGGCTTTCACCCACTATTCTTGCCTTGCTTCCAAACTGGGCGGTTTATTTTACTATATACGAACAGCTCAAAGGTTTGCTCGGCTGTGACGGAATTCATGGCCTATCTTTCGGTGCCAACATGTTAGCTGCTTCAGGAGCTGGAGCTGCAACAACCATTGTGACAAATCCTTTATGGGTTGTGAAGACACGGCTACAAACTCAAGGTATGAGGACAGGCCTAATGCCATATAGGGGTACACTTTCAGCTTTGAGAAAAATTGCTCATGAAGAGGGTATTCGTGGCTTATACAGTGGTCTACTACCTGCATTAGTGGGCATCAGTCATGTTGCAATTCAGTTTCCAGCCTATGAGAAGATCAAACTTTATTTGGCTAGTAGAGATGGTACCACAACTGATAAACTTGGTGCTCGTGACGTTGCTGTTGCTTCTTCAGTTTCAAAAATATTTGCATCCACATTAACGTATCCACACGAGGTTGTTAGGTCAAGGCTGCAAGAACAAGGGCACCATTCTGAAAAGAGATACGCAGGAATGATGGATTGCATGAAGAAAGTATTTGAAAAGGAAGGGCTTCGTGGGTTTTATCGTGGTTGTGCTACAAACTTATTGAGGACAACCCCTGCTGCGGTTATAACGTTTACAAGCTTTGAAATGATTCACCGGTTTCTTGTCACTTTATTCCCTTCTGACCCTCATCCTCACACATTATCAAGATAA 951 44.79 MATDAYAPTSFPILCNAAAGASAGVIAATFVCPLDVIKTRFQVHGLPQLNGGTVRGSLIIGSLEQIFRKEGTRGLYRGLSPTILALLPNWAVYFTIYEQLKGLLGCDGIHGLSFGANMLAASGAGAATTIVTNPLWVVKTRLQTQGMRTGLMPYRGTLSALRKIAHEEGIRGLYSGLLPALVGISHVAIQFPAYEKIKLYLASRDGTTTDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYAGMMDCMKKVFEKEGLRGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPSDPHPHTLSR 316
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Cobi2g02264 316 FunFam Nicotinamide adenine dinucleotide transporter 1, chloroplastic 4 108 - -
Cobi2g02264 316 PRINTS Mitochondrial carrier protein signature 29 43 IPR002067 GO:0055085(InterPro)
Cobi2g02264 316 PRINTS Mitochondrial carrier protein signature 127 145 IPR002067 GO:0055085(InterPro)
Cobi2g02264 316 PRINTS Mitochondrial carrier protein signature 78 98 IPR002067 GO:0055085(InterPro)
Cobi2g02264 316 PRINTS Mitochondrial carrier protein signature 16 29 IPR002067 GO:0055085(InterPro)
Cobi2g02264 316 PRINTS Mitochondrial carrier protein signature 221 243 IPR002067 GO:0055085(InterPro)
Cobi2g02264 316 ProSiteProfiles Solute carrier (Solcar) repeat profile. 212 300 IPR018108 -
Cobi2g02264 316 Gene3D Mitochondrial carrier domain 109 304 IPR023395 -
Cobi2g02264 316 FunFam NAD+ transporter 110 305 - -
Cobi2g02264 316 ProSiteProfiles Solute carrier (Solcar) repeat profile. 11 103 IPR018108 -
Cobi2g02264 316 Gene3D Mitochondrial carrier domain 2 108 IPR023395 -
Cobi2g02264 316 SUPERFAMILY Mitochondrial carrier 11 296 IPR023395 -
Cobi2g02264 316 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 13 305 IPR044712 GO:0006862(InterPro)|GO:0022857(PANTHER)|GO:0035352(PANTHER)|GO:0051724(PANTHER)|GO:0055085(PANTHER)|GO:0055085(InterPro)
Cobi2g02264 316 ProSiteProfiles Solute carrier (Solcar) repeat profile. 112 200 IPR018108 -
Cobi2g02264 316 Pfam Mitochondrial carrier protein 112 202 IPR018108 -
Cobi2g02264 316 Pfam Mitochondrial carrier protein 12 105 IPR018108 -
Cobi2g02264 316 Pfam Mitochondrial carrier protein 218 302 IPR018108 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cobi2g02264 K15115 solute carrier family 25 (mitochondrial folate transporter), member 32
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
1793824 Cobi Cobi2g00508 Cobi-Chr2:6353490 Cobi2g02264 Cobi-Chr2:69333999
1795203 Cobi Cobi2g02264 Cobi-Chr2:69333999 Cobi9g02188 Cobi-Chr9:66516536
1820010 Cobi Cobi2g02264 Cobi-Chr2:69333999 Cobi12g00262 Cobi-Chr12:2501739
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cobi2g00366 ACH 1 223 Chloroplast and Mitochondria gene family AT1G14730 60.538 1.61e-94 274.0
Cobi2g00367 ACH 4 214 Chloroplast and Mitochondria gene family AT4G25570 42.654 6.12e-60 186.0
Cobi2g00508 WGDA 33 319 Chloroplast and Mitochondria gene family AT1G25380 59.727 4.15e-117 340.0
Cobi3g01193 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.302 2.20e-179 492.0
Cobi3g01194 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.057 0.0 496.0
Cobi1g03371 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.307 1.32e-164 456.0
Cobi1g03689 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.342 0.0 508.0
Cobi1g03866 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 69.452 2.39e-174 486.0
Cobi1g04122 ACH 1 363 Chloroplast and Mitochondria gene family AT5G14040 69.146 0.0 503.0
Cobi1g04348 ACH 55 192 Chloroplast and Mitochondria gene family AT3G61470 58.696 3.17e-53 170.0
Cobi1g04550 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.606 2.42e-61 192.0
Cobi1g04632 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 84.698 2.38e-153 428.0
Cobi1g04633 ACH,WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.986 8.35e-155 431.0
Cobi1g05030 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 71.019 2.83e-173 481.0
Cobi1g05031 . 1 320 Chloroplast and Mitochondria gene family AT5G15640 73.125 2.43e-179 496.0
Cobi2g03119 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 68.392 0.0 518.0
Cobi2g02899 ACH 34 255 Chloroplast and Mitochondria gene family AT3G61470 52.252 5.14e-75 226.0
Cobi2g02264 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 75.649 2.91e-164 458.0
Cobi2g02247 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.625 2.08e-29 114.0
Cobi2g01608 . 87 271 Chloroplast and Mitochondria gene family AT4G03320 41.053 2.84e-43 145.0
Cobi11g00200 . 37 321 Chloroplast and Mitochondria gene family AT1G25380 25.938 8.33e-30 115.0
Cobi11g00701 . 2 373 Chloroplast and Mitochondria gene family AT5G14040 77.688 0.0 585.0
Cobi11g00972 WGDA 30 300 Chloroplast and Mitochondria gene family AT2G47490 37.676 1.30e-46 157.0
Cobi11g01041 . 7 306 Chloroplast and Mitochondria gene family AT2G17270 64.57 3.82e-149 419.0
Cobi11g01155 . 7 101 Chloroplast and Mitochondria gene family AT5G14040 50.526 7.24e-20 80.9
Cobi11g02041 . 1 364 Chloroplast and Mitochondria gene family AT5G14040 74.176 0.0 546.0
Cobi11g02599 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.847 2.36e-160 446.0
Cobi9g00476 . 8 329 Chloroplast and Mitochondria gene family AT2G30160 70.769 3.51e-163 456.0
Cobi9g00318 WGDA 49 449 Chloroplast and Mitochondria gene family AT2G28800 76.049 0.0 597.0
Cobi9g00287 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 82.847 8.27e-160 444.0
Cobi6g02280 ACH,WGDA 3 280 Chloroplast and Mitochondria gene family AT4G10340 83.63 3.69e-153 427.0
Cobi10g00478 . 4 580 Chloroplast and Mitochondria gene family AT4G21490 66.437 0.0 793.0
Cobi10g00622 . 164 254 Chloroplast and Mitochondria gene family AT3G61470 95.604 6.79e-59 179.0
Cobi10g00624 . 164 254 Chloroplast and Mitochondria gene family AT3G61470 95.604 6.79e-59 179.0
Cobi10g00626 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 1.22e-150 421.0
Cobi4g00968 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 66.829 4.48e-102 296.0
Cobi10g02114 . 19 228 Chloroplast and Mitochondria gene family AT5G38630 46.19 2.15e-52 165.0
Cobi10g01919 . 88 300 Chloroplast and Mitochondria gene family AT4G25700 86.854 8.70e-140 391.0
Cobi12g01320 . 18 316 Chloroplast and Mitochondria gene family AT1G07030 29.605 1.22e-31 123.0
Cobi12g00528 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 85.833 1.39e-143 400.0
Cobi12g00489 . 37 318 Chloroplast and Mitochondria gene family AT1G07030 32.042 1.07e-32 122.0
Cobi12g00262 WGDA 33 327 Chloroplast and Mitochondria gene family AT1G25380 66.113 5.09e-142 404.0
Cobi6g00201 WGDA 41 447 Chloroplast and Mitochondria gene family AT2G28800 76.773 0.0 607.0
Cobi2g00793 . 42 407 Chloroplast and Mitochondria gene family AT2G28800 59.694 2.51e-155 449.0
Cobi3g03404 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.679 7.45e-163 456.0
Cobi3g03316 WGDA 4 187 Chloroplast and Mitochondria gene family AT1G17530 60.326 1.49e-69 208.0
Cobi3g03049 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.946 1.71e-153 426.0
Cobi3g02803 . 9 316 Chloroplast and Mitochondria gene family AT1G07030 31.013 5.74e-35 127.0
Cobi3g02648 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 5.14e-123 349.0
Cobi3g02647 ACH 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 3.54e-123 350.0
Cobi5g00416 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 6.84e-171 471.0
Cobi5g00297 ACH 3 220 Chloroplast and Mitochondria gene family AT1G14730 38.532 7.50e-52 165.0
Cobih2tg0045l_1g00001 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 69.452 2.39e-174 486.0
Cobi9g03204 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.982 4.59e-115 327.0
Cobi9g03043 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.806 0.0 513.0
Cobi8g02489 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 66.228 1.53e-110 316.0
Cobi7g02410 . 16 306 Chloroplast and Mitochondria gene family AT2G17270 69.416 8.32e-161 448.0
Cobi7g02278 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 89.179 6.06e-174 478.0
Cobi7g02277 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 9.30e-172 473.0
Cobi7g01685 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.767 1.36e-161 454.0
Cobi7g01572 WGDA 1 187 Chloroplast and Mitochondria gene family AT1G17530 63.102 1.12e-75 223.0
Cobi7g00493 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.558 1.09e-151 421.0
Cobi12g02617 ACH 1 341 Chloroplast and Mitochondria gene family AT5G26200 56.232 8.70e-128 366.0
Cobi4g01418 . 46 548 Chloroplast and Mitochondria gene family AT2G18710 81.018 0.0 827.0
Cobi8g01827 . 45 254 Chloroplast and Mitochondria gene family AT3G61470 94.762 2.92e-150 418.0
Cobi8g02162 . 143 354 Chloroplast and Mitochondria gene family AT2G28800 20.628 1.61e-06 48.5
Cobi4g00312 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.86e-169 467.0
Cobi4g00311 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.12e-168 465.0
Cobi4g00303 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.86e-169 467.0
Cobi4g00302 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.12e-168 465.0
Cobi5g02679 ACH 16 224 Chloroplast and Mitochondria gene family AT5G38630 42.105 4.24e-57 179.0
Cobi5g02568 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.194 2.89e-168 464.0
Cobi2g03860 . 29 354 Chloroplast and Mitochondria gene family AT5G54290 71.865 2.81e-148 421.0
Cobi2g03905 . 29 354 Chloroplast and Mitochondria gene family AT5G54290 71.865 7.11e-148 420.0
Cobih2tg0771l_1g00008 . 64 306 Chloroplast and Mitochondria gene family AT1G25380 26.871 1.61e-28 112.0
Cobih2tg0886l_1g00002 . 87 271 Chloroplast and Mitochondria gene family AT4G03320 41.053 5.00e-43 146.0
Cobi9g01304 . 181 213 Chloroplast and Mitochondria gene family AT2G05100 63.636 1.50e-07 45.4
Cobi9g01777 . 24 111 Chloroplast and Mitochondria gene family AT1G72820 61.364 4.22e-35 120.0
Cobi9g02188 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.143 2.40e-47 159.0
Cobi9g02299 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 63.18 7.28e-108 308.0
Cobi4g03150 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.891 6.36e-168 469.0
Cobi4g01872 . 8 146 Chloroplast and Mitochondria gene family AT1G07020 41.429 4.51e-21 80.9
Cobi4g01699 . 70 347 Chloroplast and Mitochondria gene family AT1G72820 52.5 4.46e-83 249.0
Cobi4g01665 . 1 71 Chloroplast and Mitochondria gene family AT5G05370 70.423 2.93e-35 112.0
Cobi6g02641 WGDA 44 307 Chloroplast and Mitochondria gene family AT3G27240 92.424 9.25e-165 476.0
Cobi8g00023 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 79.225 2.72e-175 488.0
Cobi8g00441 . 24 111 Chloroplast and Mitochondria gene family AT1G72820 60.227 2.83e-34 118.0
Cobi8g01263 ACH 12 236 Chloroplast and Mitochondria gene family AT1G26100 64.53 2.35e-93 272.0