AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cobi2g02277 ATGGGTATCGATCTTGTTGCCGGTGGTAAGAGCAAGCGAACCAAACGAACCGCCCCTAGGTCCGACGATATCTACCTCAAACTCCTCGTCAAGTTGTATCGGTTTTTGGTGAGGAGGACTGGAAGCAACTTCAATGCGGTGATTTTGAAGAGGCTTTTTATGAGCAAAGTCAACAAGCCTCCGATTTCACTCTCTCGTCTCATTCGTTACATGTCCGCCAAGGATGATAAGATTGCCGTCGTAGTGGGAACGGTTACAGACGACGTTAGGGTTGATGAAATCCCGTGTTTGAAGGTAACCGCATTGAGGTTTACTGAGACTGCAAGAGCCAGGATTGAGAAGGCTGGTGGTGAATGTTTGACCTTTGACCAGCTCGCTCTTCGTGCTCCTCTTGGACAGAACACTGTTCTTCTTAGAGGACCAAAGAACTCACGTGAAGCTGTGAAGCATTTTGGTGCTGCTCCTGGTGTACCACACAGTCACACTAAGCCTTATGTGAGATCAAAGGGAAGGAAGTTCGAGAAGGCAAGAGGTAGAAGAAACAGCAGGGGATTTAGAAACTAG 564 47.87 MGIDLVAGGKSKRTKRTAPRSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIRYMSAKDDKIAVVVGTVTDDVRVDEIPCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGAAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRN 187
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Cobi2g02277 187 FunFam 60S ribosomal protein L18 1 187 - -
Cobi2g02277 187 SUPERFAMILY Ribosomal proteins L15p and L18e 21 139 IPR036227 -
Cobi2g02277 187 MobiDBLite consensus disorder prediction 151 187 - -
Cobi2g02277 187 Pfam Ribosomal protein 60S L18 and 50S L18e 2 186 IPR021131 -
Cobi2g02277 187 Gene3D - 1 187 - -
Cobi2g02277 187 MobiDBLite consensus disorder prediction 164 187 - -
Cobi2g02277 187 PANTHER 60S RIBOSOMAL PROTEIN L18 1 187 IPR000039 GO:0003723(PANTHER)|GO:0003735(PANTHER)|GO:0003735(InterPro)|GO:0005840(InterPro)|GO:0006412(InterPro)|GO:0022625(PANTHER)
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cobi2g02277 K02883 large subunit ribosomal protein L18e
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
70589 Cobi1g03281 Cobi2g02277
71411 Cobi2g02277 Cobi4g00672
377593 Cobi2g02277 Cobi6g01028
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Cobi Cobi-Chr10:603639 Cobi2g02277 Cobi-Chr2:69679543 dispersed
Cobi Cobi-Chr1:82196596 Cobi2g02277 Cobi-Chr2:69679543 wgd
Cobi Cobi-Chr2:69679543 Cobi4g00672 Cobi-Chr4:6087537 wgd
Cobi Cobi-Chr2:69679543 Cobi6g01028 Cobi-Chr6:8273852 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cobi2g00389 . 81 133 Cytoplasmic Ribosomal Protein gene family AT4G15000 69.811 1.12e-17 74.3
Cobi3g00557 ACH 30 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 80.247 3.34e-85 260.0
Cobi3g00749 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.34e-50 156.0
Cobi3g00750 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.87e-49 156.0
Cobi3g00823 . 24 121 Cytoplasmic Ribosomal Protein gene family AT3G45030 31.313 7.61e-08 47.4
Cobi3g00838 ACH,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.854 1.60e-126 355.0
Cobi3g00915 ACH 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.473 8.16e-179 490.0
Cobi3g01117 . 13 126 Cytoplasmic Ribosomal Protein gene family AT3G07110 31.061 7.44e-07 46.6
Cobi3g01246 ACH 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 84.232 9.64e-154 425.0
Cobi1g02736 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 81.41 2.26e-83 242.0
Cobi1g02748 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 87.879 2.06e-57 174.0
Cobi1g02775 ACH 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 1.10e-86 251.0
Cobi1g02776 . 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 8.69e-87 249.0
Cobi1g02839 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 64.655 7.84e-46 142.0
Cobi1g02850 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 1.48e-71 207.0
Cobi1g02866 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 8.10e-126 351.0
Cobi1g02966 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 79.259 3.39e-79 228.0
Cobi1g03171 WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Cobi1g03281 ACH 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 84.946 1.32e-117 329.0
Cobi1g03298 ACH 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.112 3.42e-126 353.0
Cobi1g03356 ACH 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.695 0.0 502.0
Cobi1g03414 . 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.54 5.73e-153 428.0
Cobi1g03487 ACH,WGDA 4 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 80.893 0.0 667.0
Cobi1g04054 ACH,WGDA 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 57.2 1.17e-87 267.0
Cobi1g04058 ACH 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.77 1.41e-64 191.0
Cobi1g04085 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 41.892 3.59e-06 44.7
Cobi1g04172 ACH,WGDA 1 171 Cytoplasmic Ribosomal Protein gene family AT1G67430 91.813 2.49e-119 332.0
Cobi1g04299 ACH,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 78.534 5.69e-111 315.0
Cobi1g04377 ACH,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 83.916 1.06e-89 258.0
Cobi1g04425 ACH 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 85.992 7.77e-169 464.0
Cobi1g04663 . 9 211 Cytoplasmic Ribosomal Protein gene family AT2G27530 25.238 6.52e-07 48.1
Cobi1g04775 ACH 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 82.119 2.57e-84 242.0
Cobi1g05063 ACH,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT3G02080 81.818 1.05e-88 253.0
Cobi2g02979 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 86.986 6.71e-93 265.0
Cobi2g02909 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.0 1.23e-75 218.0
Cobi2g02816 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.77 4.06e-171 470.0
Cobi2g02550 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 64.655 1.86e-45 141.0
Cobi2g02522 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 88.725 3.51e-123 348.0
Cobi2g02386 ACH 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.806 6.92e-85 242.0
Cobi2g02277 ACH,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 3.00e-119 333.0
Cobi2g02268 ACH,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.834 1.51e-126 353.0
Cobi2g01401 WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 76.923 1.25e-80 238.0
Cobi11g00048 ACH 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.364 6.86e-85 244.0
Cobi11g00221 ACH,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.071 3.51e-75 216.0
Cobi11g00288 ACH,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.662 3.50e-72 212.0
Cobi11g00293 ACH,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 87.705 9.59e-72 209.0
Cobi11g00382 ACH,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 89.815 5.63e-55 164.0
Cobi11g00477 ACH,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 1.14e-93 289.0
Cobi11g00609 ACH 1 164 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.024 5.30e-106 298.0
Cobi11g00651 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 69.298 2.92e-31 116.0
Cobi11g00654 ACH 66 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 93.377 1.46e-86 250.0
Cobi11g00693 . 1 64 Cytoplasmic Ribosomal Protein gene family AT5G64140 93.846 3.48e-37 118.0
Cobi11g00745 . 5 192 Cytoplasmic Ribosomal Protein gene family AT3G53870 89.894 2.15e-119 338.0
Cobi11g00929 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 79.605 4.38e-82 236.0
Cobi11g01903 ACH,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 78.761 8.79e-62 183.0
Cobi11g01906 . 10 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 84.722 8.42e-45 136.0
Cobi11g02335 WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 74.825 1.69e-75 219.0
Cobi11g02496 ACH,WGDA 9 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 44.304 2.54e-34 115.0
Cobi11g02521 ACH,WGDA 6 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 83.682 3.17e-151 419.0
Cobi11g02628 ACH 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.695 0.0 500.0
Cobi11g02629 . 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.695 0.0 500.0
Cobi11g02706 . 1 208 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.615 1.27e-127 356.0
Cobi11g02745 . 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 84.921 2.93e-61 182.0
Cobi11g02795 WGDA 6 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 85.816 1.99e-90 257.0
Cobi9g00498 WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40510 80.531 4.96e-62 184.0
Cobi9g00313 ACH,WGDA 14 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.436 9.22e-83 236.0
Cobi5g02844 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Cobi5g02843 ACH,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Cobi5g02741 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 36.486 9.24e-07 45.8
Cobi6g02557 ACH,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 81.818 4.41e-89 253.0
Cobi6g02416 . 51 154 Cytoplasmic Ribosomal Protein gene family AT2G39460 46.154 4.32e-21 84.0
Cobi6g02367 . 2 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 63.768 7.35e-19 80.5
Cobi6g02146 ACH 127 199 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.137 5.11e-06 43.1
Cobi6g02114 ACH,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G61170 85.915 9.24e-91 258.0
Cobi6g02015 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 82.877 1.95e-88 254.0
Cobi6g01970 ACH,WGDA 1 174 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.805 3.04e-120 335.0
Cobi6g01911 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 4.06e-07 47.8
Cobi6g01898 ACH,WGDA 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 57.2 1.39e-90 267.0
Cobi6g01641 ACH,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 5.03e-81 233.0
Cobi6g01550 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Cobi6g01494 . 1 387 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.406 0.0 718.0
Cobi10g00016 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.928 5.75e-92 261.0
Cobi10g00024 . 11 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 86.842 6.98e-60 178.0
Cobi10g00025 ACH 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 1.12e-118 337.0
Cobi10g00116 ACH,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 34.722 3.61e-08 50.8
Cobi10g00172 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 47.887 1.27e-16 73.9
Cobi10g00283 ACH 1 93 Cytoplasmic Ribosomal Protein gene family AT5G24510 63.158 1.88e-35 115.0
Cobi10g00428 . 15 128 Cytoplasmic Ribosomal Protein gene family AT2G42740 28.226 1.20e-06 46.2
Cobi10g00470 WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Cobi10g00549 WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.964 3.16e-152 422.0
Cobi10g00587 ACH,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Cobi10g00753 WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 94.203 6.42e-44 134.0
Cobi4g00544 ACH 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Cobi4g00667 ACH 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 85.238 9.08e-127 354.0
Cobi4g00672 ACH,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT3G05590 86.022 9.89e-121 337.0
Cobi4g00680 . 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 82.677 2.20e-60 180.0
Cobi4g00737 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.806 1.45e-84 243.0
Cobi4g00740 ACH,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 2.74e-107 300.0
Cobi4g00818 . 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.328 2.22e-79 228.0
Cobi4g00874 ACH,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.835 3.34e-138 383.0
Cobi4g00918 ACH,WGDA 53 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 88.889 3.55e-52 157.0
Cobi4g00929 ACH,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 81.667 4.69e-69 202.0
Cobi4g00952 ACH 87 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 35.385 2.92e-07 45.1
Cobi4g01137 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Cobi4g01189 ACH 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 95.385 1.02e-89 256.0
Cobi4g01295 . 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40010 71.681 5.56e-55 172.0
Cobi4g01297 . 113 287 Cytoplasmic Ribosomal Protein gene family AT2G40010 78.286 2.56e-97 284.0
Cobi5g00824 . 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 90.278 1.92e-130 364.0
Cobi5g00832 . 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 69.912 1.49e-30 114.0
Cobi5g00878 ACH,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Cobi5g01036 ACH 1 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 42.667 1.04e-11 61.2
Cobi5g01131 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 4.06e-47 156.0
Cobi2g00188 . 5 106 Cytoplasmic Ribosomal Protein gene family AT2G40010 42.157 1.52e-22 88.6
Cobi2g00096 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 89.815 5.63e-55 164.0
Cobi2g00062 ACH 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 82.963 3.86e-82 235.0
Cobi10g02356 ACH,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.024 5.30e-106 298.0
Cobi10g02321 ACH 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.727 2.86e-146 405.0
Cobi10g02248 WGDA 1 294 Cytoplasmic Ribosomal Protein gene family AT3G25520 82.313 0.0 509.0
Cobi10g02205 ACH 20 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 88.596 2.02e-74 218.0
Cobi10g02023 . 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 86.26 1.95e-78 226.0
Cobi10g01988 ACH 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Cobi10g01921 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 75.641 7.49e-82 238.0
Cobi10g01909 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 4.24e-58 173.0
Cobi10g01624 . 1 72 Cytoplasmic Ribosomal Protein gene family AT3G62250 65.278 3.98e-22 90.5
Cobi10g01401 . 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.26 3.64e-163 451.0
Cobi10g01252 . 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 82.192 0.0 510.0
Cobi10g01239 . 1 51 Cytoplasmic Ribosomal Protein gene family AT4G31985 92.157 3.44e-31 103.0
Cobi10g01185 ACH,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.835 3.94e-137 380.0
Cobi10g01169 ACH,WGDA 15 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.874 2.06e-74 216.0
Cobi10g01161 ACH,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT4G26230 82.353 1.02e-70 208.0
Cobi2g01252 WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 5.06e-126 352.0
Cobi12g02213 ACH 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.473 8.16e-179 490.0
Cobi12g02141 ACH,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 84.541 5.05e-127 356.0
Cobi12g01850 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 95.652 1.76e-44 135.0
Cobi12g01612 ACH,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.405 2.27e-165 456.0
Cobi12g01606 ACH,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Cobi12g01594 . 65 108 Cytoplasmic Ribosomal Protein gene family AT1G77940 86.364 2.37e-22 82.0
Cobi12g01592 . 22 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 91.209 1.71e-59 175.0
Cobi12g01539 . 1 160 Cytoplasmic Ribosomal Protein gene family AT3G48930 89.375 3.45e-96 273.0
Cobi12g01462 WGDA 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.5 2.27e-93 265.0
Cobi12g01328 ACH,WGDA 1 90 Cytoplasmic Ribosomal Protein gene family AT3G52590 35.556 1.03e-10 58.5
Cobi12g01108 ACH 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Cobi12g01080 . 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 80.0 7.98e-78 225.0
Cobi12g01027 ACH,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 1.03e-101 288.0
Cobi12g00999 . 17 45 Cytoplasmic Ribosomal Protein gene family AT3G11940 62.069 4.48e-07 42.7
Cobi12g00994 . 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 1.51e-125 353.0
Cobi12g00921 ACH 1 164 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.024 5.30e-106 298.0
Cobi12g00668 WGDA 1 176 Cytoplasmic Ribosomal Protein gene family AT4G25740 77.473 5.54e-84 245.0
Cobi12g00639 WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 1.40e-125 353.0
Cobi12g00583 ACH 1 112 Cytoplasmic Ribosomal Protein gene family AT1G07070 91.071 2.76e-75 216.0
Cobi12g00549 ACH 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 2.16e-72 212.0
Cobi12g00094 WGDA 1 167 Cytoplasmic Ribosomal Protein gene family AT1G67430 93.413 6.30e-119 331.0
Cobi12g00035 WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Cobi6g00126 ACH,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.623 1.71e-80 230.0
Cobi6g00196 ACH,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.923 3.62e-92 260.0
Cobi6g00275 WGDA 1 110 Cytoplasmic Ribosomal Protein gene family AT3G56340 80.909 1.58e-60 180.0
Cobi6g00290 WGDA 1 294 Cytoplasmic Ribosomal Protein gene family AT3G25520 79.252 5.72e-179 494.0
Cobi6g00337 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.105 1.06e-117 331.0
Cobi6g00408 WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G52300 87.368 4.30e-57 169.0
Cobi6g00579 WGDA 1 137 Cytoplasmic Ribosomal Protein gene family AT5G04800 83.453 2.72e-80 231.0
Cobi6g00596 ACH 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 83.246 2.04e-122 344.0
Cobi6g00609 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 90.278 1.92e-130 364.0
Cobi6g00613 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 71.681 8.54e-35 115.0
Cobi6g00655 ACH,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 87.952 2.35e-106 299.0
Cobi6g00947 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 3.11e-49 156.0
Cobi6g00979 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 79.828 3.73e-121 343.0
Cobi6g01028 ACH,WGDA 1 178 Cytoplasmic Ribosomal Protein gene family AT5G27850 82.022 1.03e-108 314.0
Cobi6g01032 ACH,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 85.308 6.14e-126 352.0
Cobi6g01057 ACH 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 2.74e-107 300.0
Cobi6g01064 . 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Cobi6g01069 . 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 86.26 3.42e-79 228.0
Cobi6g01132 . 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 6.24e-138 382.0
Cobi6g01133 . 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 87.864 6.38e-137 380.0
Cobi6g01185 . 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.247 7.76e-90 256.0
Cobi1g01615 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.624 3.25e-121 342.0
Cobi1g01437 . 2 213 Cytoplasmic Ribosomal Protein gene family AT3G11250 21.461 9.66e-10 55.8
Cobi10g02879 . 1 82 Cytoplasmic Ribosomal Protein gene family AT3G52590 39.024 1.23e-09 55.1
Cobi10g02875 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 81.053 4.25e-116 326.0
Cobi10g02828 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 2.12e-46 157.0
Cobi10g02827 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 2.07e-46 157.0
Cobi10g02807 ACH,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 8.29e-58 171.0
Cobi10g02598 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 64.286 1.34e-20 85.5
Cobi10g02597 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 52.174 4.49e-15 69.7
Cobi10g02596 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G62250 62.857 6.24e-20 84.3
Cobi10g02588 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G62250 63.768 7.06e-20 84.3
Cobi10g02573 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 56.0 2.04e-21 87.0
Cobi10g02572 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 60.0 3.94e-25 97.1
Cobi10g02571 . 2 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 51.316 1.44e-16 73.9
Cobi10g02569 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 49.333 2.19e-17 75.9
Cobi10g02550 WGDA 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.517 6.64e-80 230.0
Cobi2g00967 ACH 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 88.961 2.05e-75 220.0
Cobi2g00951 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 87.705 2.15e-71 207.0
Cobi2g00845 ACH,WGDA 1 153 Cytoplasmic Ribosomal Protein gene family AT1G23410 90.196 6.28e-89 255.0
Cobi2g00761 WGDA 1 171 Cytoplasmic Ribosomal Protein gene family AT1G67430 91.813 2.39e-118 333.0
Cobi2g00703 ACH 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 95.349 2.21e-59 174.0
Cobi2g00689 ACH 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.0 1.38e-76 220.0
Cobi2g00676 . 1 218 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.156 2.09e-144 401.0
Cobi3g03604 . 1 159 Cytoplasmic Ribosomal Protein gene family AT2G44860 71.069 4.76e-84 242.0
Cobi3g03544 WGDA 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 3.10e-06 43.1
Cobi3g03466 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 1.32e-68 199.0
Cobi3g03338 WGDA 12 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 81.781 8.97e-148 414.0
Cobi3g03299 ACH,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 74.126 7.04e-67 215.0
Cobi3g03214 WGDA 2 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 42.949 1.33e-33 114.0
Cobi3g03200 WGDA 50 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 87.692 8.12e-129 362.0
Cobi3g03192 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.928 4.46e-91 261.0
Cobi3g03165 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 90.741 2.47e-55 166.0
Cobi3g03130 WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.932 4.06e-91 259.0
Cobi3g03081 . 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.05 1.47e-95 271.0
Cobi3g02937 . 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 94.444 4.47e-128 355.0
Cobi3g02794 . 12 386 Cytoplasmic Ribosomal Protein gene family AT1G43170 87.071 0.0 677.0
Cobi3g02707 ACH,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.321 5.18e-127 356.0
Cobi3g02611 ACH,WGDA 25 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.333 5.86e-64 189.0
Cobi3g02551 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 86.986 4.23e-92 261.0
Cobi3g02507 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 90.0 1.05e-75 218.0
Cobi3g02416 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.16 1.69e-171 471.0
Cobi3g01962 WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 75.916 4.49e-112 317.0
Cobi5g00755 WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.545 1.71e-124 352.0
Cobi5g00706 . 127 184 Cytoplasmic Ribosomal Protein gene family AT3G62870 93.103 8.11e-37 124.0
Cobi5g00704 . 10 121 Cytoplasmic Ribosomal Protein gene family AT1G43170 73.214 1.62e-45 149.0
Cobi5g00698 WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 3.46e-101 285.0
Cobi5g00641 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 61.739 4.28e-41 130.0
Cobi5g00627 WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Cobi5g00547 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 1.19e-57 174.0
Cobi5g00418 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 87.5 3.18e-119 333.0
Cobi5g00113 ACH 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 8.28e-78 223.0
Cobi5g00108 ACH,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Cobi5g00050 ACH 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.053 8.32e-108 302.0
Cobi4g00036 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 5.09e-47 156.0
Cobih2tg0040l_1g00045 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 49.296 8.64e-16 72.0
Cobi6g03989 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 5.32e-166 457.0
Cobi6g04054 . 84 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 39.706 5.03e-07 45.4
Cobi9g03328 ACH,WGDA 1 127 Cytoplasmic Ribosomal Protein gene family AT3G49910 87.402 2.65e-79 230.0
Cobi8g02775 ACH,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.278 3.95e-10 56.6
Cobi8g02511 . 50 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 31.034 2.45e-10 55.5
Cobi1g00324 ACH,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.023 3.23e-164 461.0
Cobi1g00316 ACH,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Cobi3g00056 . 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 85.0 9.78e-72 208.0
Cobi9g00129 ACH,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.623 8.27e-80 230.0
Cobi1g01759 WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 86.498 5.98e-148 414.0
Cobi1g01761 WGDA 4 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 90.833 1.30e-78 226.0
Cobi9g02907 ACH 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Cobi9g02775 ACH 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.0 1.49e-80 231.0
Cobi9g02718 . 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 88.356 5.46e-93 264.0
Cobi9g02661 ACH,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 5.22e-73 211.0
Cobi9g02653 ACH,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 86.364 4.31e-72 211.0
Cobi9g02632 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 8.45e-48 156.0
Cobi2g03297 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 69.912 2.26e-33 111.0
Cobi2g03331 ACH 15 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 84.974 3.05e-126 354.0
Cobi2g03350 ACH,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 2.19e-101 287.0
Cobi2g03459 ACH,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 1.63e-95 282.0
Cobi2g03636 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G62250 37.5 1.84e-07 50.8
Cobi2g03755 ACH 1 61 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.148 5.55e-06 43.9
Cobi2g03783 ACH,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.366 1.19e-126 355.0
Cobi10g02477 ACH,WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.143 9.52e-28 96.3
Cobi10g02489 WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 90.278 1.54e-131 367.0
Cobi7g03038 . 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 87.368 2.37e-57 169.0
Cobi7g02649 . 78 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.333 3.06e-66 199.0
Cobi7g02644 . 1 129 Cytoplasmic Ribosomal Protein gene family AT4G29430 74.419 1.63e-73 213.0
Cobi7g02467 ACH 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Cobi7g02403 . 5 77 Cytoplasmic Ribosomal Protein gene family AT3G62250 31.507 6.31e-06 44.7
Cobi7g02352 . 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.518 5.51e-152 421.0
Cobi7g02246 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 87.5 2.03e-119 333.0
Cobi7g02245 . 18 153 Cytoplasmic Ribosomal Protein gene family AT1G29970 45.39 8.04e-33 112.0
Cobi7g02159 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.743 1.18e-179 497.0
Cobi7g02100 . 96 251 Cytoplasmic Ribosomal Protein gene family AT2G41840 29.091 7.84e-15 71.6
Cobi7g02059 ACH 38 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 26.667 3.94e-07 45.1
Cobi7g01898 WGDA 127 204 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.769 1.98e-06 43.5
Cobi7g01786 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 1.32e-68 199.0
Cobi7g01604 WGDA 12 254 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.377 1.00e-147 415.0
Cobi7g01579 . 87 151 Cytoplasmic Ribosomal Protein gene family AT1G29970 31.343 1.21e-06 43.1
Cobi7g01505 . 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 1.87e-06 42.0
Cobi7g01498 . 6 125 Cytoplasmic Ribosomal Protein gene family AT3G04400 32.331 2.52e-06 43.1
Cobi7g01192 . 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 76.812 1.82e-31 106.0
Cobi7g01157 ACH,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 7.25e-146 408.0
Cobi7g01147 ACH,WGDA 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 90.244 2.06e-79 229.0
Cobi7g00891 ACH 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 5.47e-145 401.0
Cobi7g00888 . 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 5.47e-145 401.0
Cobi7g00843 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.962 1.02e-83 239.0
Cobi7g00768 ACH,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Cobi7g00669 ACH,WGDA 14 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 90.0 1.50e-78 226.0
Cobi7g00544 . 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.05 7.54e-96 272.0
Cobi1g02562 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 5.97e-71 206.0
Cobi1g02614 ACH 1 61 Cytoplasmic Ribosomal Protein gene family AT1G74270 90.164 2.44e-36 117.0
Cobi1g02617 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.743 1.18e-179 497.0
Cobi1g02618 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.429 5.47e-179 495.0
Cobi12g02474 ACH 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Cobi8g01763 WGDA 1 247 Cytoplasmic Ribosomal Protein gene family AT2G31610 82.996 7.03e-142 410.0
Cobi8g01787 ACH,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Cobi8g02059 WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 94.203 6.42e-44 134.0
Cobi8g02125 ACH 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 1.81e-59 179.0
Cobi8g02128 ACH 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.641 4.99e-163 452.0
Cobi8g02356 ACH 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 93.377 8.03e-102 286.0
Cobi1g02468 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 89.96 2.24e-164 452.0
Cobi1g02321 ACH 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 1.00e-64 193.0
Cobi1g02218 . 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 82.716 2.42e-49 148.0
Cobi1g02209 . 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 79.646 1.47e-60 184.0
Cobi1g02208 ACH,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 79.646 2.46e-61 182.0
Cobi1g02074 ACH 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.77 6.42e-170 468.0
Cobi1g01843 ACH 26 123 Cytoplasmic Ribosomal Protein gene family AT5G59850 95.918 1.62e-67 197.0
Cobi6g03425 ACH 46 134 Cytoplasmic Ribosomal Protein gene family AT5G60670 84.27 1.19e-46 146.0
Cobi2g01023 . 41 91 Cytoplasmic Ribosomal Protein gene family AT3G57490 78.431 1.14e-21 84.3
Cobi6g03931 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.361 1.27e-164 456.0
Cobi6g03793 . 60 119 Cytoplasmic Ribosomal Protein gene family AT1G67430 61.667 6.43e-15 68.2
Cobi4g00277 WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Cobi10g00814 . 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 86.567 1.09e-80 233.0
Cobi10g00951 ACH 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 2.01e-92 262.0
Cobi10g00971 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Cobi10g01010 ACH 3 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 72.441 1.52e-55 179.0
Cobi10g01012 ACH 48 282 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.957 3.64e-146 409.0
Cobi10g01014 . 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 2.35e-146 409.0
Cobi1g00255 WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 89.286 8.91e-68 211.0
Cobi1g00194 . 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 87.421 1.43e-94 269.0
Cobi1g00086 WGDA 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.5 2.15e-93 266.0
Cobi2g01341 ACH 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 87.582 2.22e-87 252.0
Cobih2tg0105l_1g00005 . 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 3.92e-88 272.0
Cobih2tg0105l_1g00026 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Cobi5g02567 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 86.932 1.01e-118 331.0
Cobi5g02411 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 3.30e-58 173.0
Cobi5g02343 WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Cobi5g02308 WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.0 4.23e-38 124.0
Cobi5g02271 WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 1.66e-101 286.0
Cobi5g02230 WGDA 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 83.495 2.99e-110 313.0
Cobi5g02203 ACH,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Cobi2g03830 ACH,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 1.56e-64 191.0
Cobi2g03875 ACH 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 90.698 3.39e-178 488.0
Cobi7g00076 ACH 4 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 41.667 5.15e-09 53.5
Cobi7g00231 . 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Cobih2tg0157l_1g00018 . 60 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 77.778 7.73e-41 129.0
Cobih2tg0157l_1g00025 . 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 81.053 4.25e-116 326.0
Cobi4g00356 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.636 1.91e-121 338.0
Cobi2g03892 ACH 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 90.698 3.39e-178 488.0
Cobih2tg0269l_1g00008 . 2 213 Cytoplasmic Ribosomal Protein gene family AT3G11250 21.461 3.46e-10 57.0
Cobi2g01126 . 34 94 Cytoplasmic Ribosomal Protein gene family AT1G52300 83.607 3.84e-31 109.0
Cobih2tg0304l_1g00028 . 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 82.192 0.0 510.0
Cobih2tg0362l_1g00004 . 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 1.56e-95 282.0
Cobih2tg0433l_1g00003 . 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 75.916 1.75e-111 317.0
Cobih2tg0530l_1g00018 . 24 141 Cytoplasmic Ribosomal Protein gene family AT4G09800 28.814 9.57e-07 43.1
Cobih2tg0715l_1g00003 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 87.879 1.13e-57 172.0
Cobih2tg0786l_1g00004 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.197 3.01e-120 340.0
Cobi9g00892 . 99 216 Cytoplasmic Ribosomal Protein gene family AT3G51190 42.373 8.69e-24 92.8
Cobi9g01115 . 1 125 Cytoplasmic Ribosomal Protein gene family AT4G15000 76.8 5.88e-69 202.0
Cobi9g01173 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 80.687 5.28e-122 344.0
Cobi9g01746 ACH 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 9.31e-101 286.0
Cobi9g01811 . 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.684 1.08e-49 154.0
Cobi9g01951 ACH 3 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 81.188 0.0 670.0
Cobi9g01961 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 9.11e-166 456.0
Cobi9g01963 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.361 1.88e-165 455.0
Cobi9g02122 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.429 4.33e-08 50.4
Cobi9g02537 ACH,WGDA 1 55 Cytoplasmic Ribosomal Protein gene family AT1G74270 90.909 5.66e-32 105.0
Cobi4g03112 ACH 16 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 43.448 9.25e-32 109.0
Cobi4g02984 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 6.38e-47 156.0
Cobi4g02980 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 5.33e-47 157.0
Cobi4g02829 . 86 133 Cytoplasmic Ribosomal Protein gene family AT5G63070 43.75 1.47e-10 52.4
Cobi4g02697 ACH 1 57 Cytoplasmic Ribosomal Protein gene family AT3G52590 33.333 2.46e-06 44.7
Cobi4g02318 . 1 390 Cytoplasmic Ribosomal Protein gene family AT1G61580 88.462 0.0 713.0
Cobi4g02316 . 1 390 Cytoplasmic Ribosomal Protein gene family AT1G61580 88.718 0.0 714.0
Cobi4g02315 . 1 390 Cytoplasmic Ribosomal Protein gene family AT1G61580 88.718 0.0 716.0
Cobi4g01769 ACH 1 259 Cytoplasmic Ribosomal Protein gene family AT5G58420 90.347 0.0 498.0
Cobi6g03313 ACH 68 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 82.258 6.65e-70 211.0
Cobi6g02961 . 1 193 Cytoplasmic Ribosomal Protein gene family AT1G33140 81.865 4.46e-118 331.0
Cobi6g02867 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 91.367 7.06e-94 266.0
Cobi6g02770 ACH,WGDA 3 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 81.436 0.0 671.0
Cobi8g00325 . 74 116 Cytoplasmic Ribosomal Protein gene family AT2G20450 51.163 1.41e-08 48.1
Cobi8g01159 ACH,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.963 2.06e-107 320.0
Cobi8g01171 ACH 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 81.457 5.30e-84 241.0
Cobi8g01279 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 1.59e-08 51.2
Cobi8g01422 ACH 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 59.893 1.66e-72 214.0
Cobi8g01499 . 5 77 Cytoplasmic Ribosomal Protein gene family AT3G62250 31.507 3.47e-06 45.4
Cobi8g01562 . 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.518 1.38e-151 420.0
Cobi8g01564 . 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.518 1.38e-151 420.0