AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cobi4g00968 ATGGCTTTCACCATTGCTTCAACCTCTTATTCATCTCTCCCAACCAGGGGAGAGTTAACCACAAAGTCACCTTGTGCTGAAAGAAGTTGTACTCCAAGGTACATGTTCAGAAGCAGGCATGTACGGAAGCTCAATGCAGGAAAAGAAGTATCAAGTGTGTGTGAACCACTTCCTGCTGACCGACCAGTATGGTTCCCTGGTACTTCTCCTCCCGAATGGCTCGATGGCAGCCTCCCCGGAGATTTTGGCTTTGACCCACTTGGATTAGGATCTGATCCAGAGTTACTTAAATGGTTTGCCCAAGCCGAGTTGATGCACAGTCGATGGGCCATGCTTGCAGTTGCGGGTATTCTGGTCCCGGAATGGCTCGAAAGTTTGGGCTTTATCGACAATTTCTCATGGTACGAAGCCGGGTCTAGAGAATACTTTGCTGACCCGACCACTTTGTTCGTGGTACAATTAGCCTTGATGGGTTGGGTTGAGGGTCGAAGATGGGCCGACATGATCAACCCCGGGTGTGTTGACATTGAGCCCAAACTACCCAACAAGAAGAAACCAAAGCCCGATGTTGGATACCCGGGTGGATTGTGGTTCGACCCGTTCATGTGGGGAAGAGGGTCTCCCGAACCAGTGATGGTTTTGAGGACCAAGGAAATAAAGAACGGGCGGCTAGCCATGCTCGCCTTTTTGGGTTTTGTTTTCCAAGCCGTTTACACCGGGCAAGGCCCCCTCGAGAACCTTTCGGCTCATCTTGCGGATCCGGGTCATGTCAACATTTTCTCGGCCTTCAGTAATCAAATATAA 804 50.25 MAFTIASTSYSSLPTRGELTTKSPCAERSCTPRYMFRSRHVRKLNAGKEVSSVCEPLPADRPVWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILVPEWLESLGFIDNFSWYEAGSREYFADPTTLFVVQLALMGWVEGRRWADMINPGCVDIEPKLPNKKKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFVFQAVYTGQGPLENLSAHLADPGHVNIFSAFSNQI 267
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Cobi4g00968 267 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 35 261 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Cobi4g00968 267 FunFam Chlorophyll a-b binding protein, chloroplastic 71 256 - -
Cobi4g00968 267 Gene3D Chlorophyll a-b binding protein domain 71 256 - -
Cobi4g00968 267 SUPERFAMILY Chlorophyll a-b binding protein 60 264 - -
Cobi4g00968 267 Pfam Chlorophyll A-B binding protein 70 236 IPR022796 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cobi4g00968 K08908 light-harvesting complex I chlorophyll a/b binding protein 2
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Cobi Cobi-Chr3:83095462 Cobi4g00968 Cobi-Chr4:8650599 dispersed
Cobi Cobi-Chr4:8650599 Cobi4g03150 Cobi-Chr4:81077996 dispersed
Cobi Cobi-Chr4:8650599 Cobi8g01827 Cobi-Chr8:68328649 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cobi2g00366 ACH 1 223 Chloroplast and Mitochondria gene family AT1G14730 60.538 1.61e-94 274.0
Cobi2g00367 ACH 4 214 Chloroplast and Mitochondria gene family AT4G25570 42.654 6.12e-60 186.0
Cobi2g00508 WGDA 33 319 Chloroplast and Mitochondria gene family AT1G25380 59.727 4.15e-117 340.0
Cobi3g01193 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.302 2.20e-179 492.0
Cobi3g01194 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.057 0.0 496.0
Cobi1g03371 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.307 1.32e-164 456.0
Cobi1g03689 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.342 0.0 508.0
Cobi1g03866 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 69.452 2.39e-174 486.0
Cobi1g04122 ACH 1 363 Chloroplast and Mitochondria gene family AT5G14040 69.146 0.0 503.0
Cobi1g04348 ACH 55 192 Chloroplast and Mitochondria gene family AT3G61470 58.696 3.17e-53 170.0
Cobi1g04550 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.606 2.42e-61 192.0
Cobi1g04632 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 84.698 2.38e-153 428.0
Cobi1g04633 ACH,WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.986 8.35e-155 431.0
Cobi1g05030 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 71.019 2.83e-173 481.0
Cobi1g05031 . 1 320 Chloroplast and Mitochondria gene family AT5G15640 73.125 2.43e-179 496.0
Cobi2g03119 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 68.392 0.0 518.0
Cobi2g02899 ACH 34 255 Chloroplast and Mitochondria gene family AT3G61470 52.252 5.14e-75 226.0
Cobi2g02264 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 75.649 2.91e-164 458.0
Cobi2g02247 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.625 2.08e-29 114.0
Cobi2g01608 . 87 271 Chloroplast and Mitochondria gene family AT4G03320 41.053 2.84e-43 145.0
Cobi11g00200 . 37 321 Chloroplast and Mitochondria gene family AT1G25380 25.938 8.33e-30 115.0
Cobi11g00701 . 2 373 Chloroplast and Mitochondria gene family AT5G14040 77.688 0.0 585.0
Cobi11g00972 WGDA 30 300 Chloroplast and Mitochondria gene family AT2G47490 37.676 1.30e-46 157.0
Cobi11g01041 . 7 306 Chloroplast and Mitochondria gene family AT2G17270 64.57 3.82e-149 419.0
Cobi11g01155 . 7 101 Chloroplast and Mitochondria gene family AT5G14040 50.526 7.24e-20 80.9
Cobi11g02041 . 1 364 Chloroplast and Mitochondria gene family AT5G14040 74.176 0.0 546.0
Cobi11g02599 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.847 2.36e-160 446.0
Cobi9g00476 . 8 329 Chloroplast and Mitochondria gene family AT2G30160 70.769 3.51e-163 456.0
Cobi9g00318 WGDA 49 449 Chloroplast and Mitochondria gene family AT2G28800 76.049 0.0 597.0
Cobi9g00287 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 82.847 8.27e-160 444.0
Cobi6g02280 ACH,WGDA 3 280 Chloroplast and Mitochondria gene family AT4G10340 83.63 3.69e-153 427.0
Cobi10g00478 . 4 580 Chloroplast and Mitochondria gene family AT4G21490 66.437 0.0 793.0
Cobi10g00622 . 164 254 Chloroplast and Mitochondria gene family AT3G61470 95.604 6.79e-59 179.0
Cobi10g00624 . 164 254 Chloroplast and Mitochondria gene family AT3G61470 95.604 6.79e-59 179.0
Cobi10g00626 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 1.22e-150 421.0
Cobi4g00968 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 66.829 4.48e-102 296.0
Cobi10g02114 . 19 228 Chloroplast and Mitochondria gene family AT5G38630 46.19 2.15e-52 165.0
Cobi10g01919 . 88 300 Chloroplast and Mitochondria gene family AT4G25700 86.854 8.70e-140 391.0
Cobi12g01320 . 18 316 Chloroplast and Mitochondria gene family AT1G07030 29.605 1.22e-31 123.0
Cobi12g00528 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 85.833 1.39e-143 400.0
Cobi12g00489 . 37 318 Chloroplast and Mitochondria gene family AT1G07030 32.042 1.07e-32 122.0
Cobi12g00262 WGDA 33 327 Chloroplast and Mitochondria gene family AT1G25380 66.113 5.09e-142 404.0
Cobi6g00201 WGDA 41 447 Chloroplast and Mitochondria gene family AT2G28800 76.773 0.0 607.0
Cobi2g00793 . 42 407 Chloroplast and Mitochondria gene family AT2G28800 59.694 2.51e-155 449.0
Cobi3g03404 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.679 7.45e-163 456.0
Cobi3g03316 WGDA 4 187 Chloroplast and Mitochondria gene family AT1G17530 60.326 1.49e-69 208.0
Cobi3g03049 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.946 1.71e-153 426.0
Cobi3g02803 . 9 316 Chloroplast and Mitochondria gene family AT1G07030 31.013 5.74e-35 127.0
Cobi3g02648 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 5.14e-123 349.0
Cobi3g02647 ACH 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 3.54e-123 350.0
Cobi5g00416 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 6.84e-171 471.0
Cobi5g00297 ACH 3 220 Chloroplast and Mitochondria gene family AT1G14730 38.532 7.50e-52 165.0
Cobih2tg0045l_1g00001 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 69.452 2.39e-174 486.0
Cobi9g03204 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.982 4.59e-115 327.0
Cobi9g03043 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.806 0.0 513.0
Cobi8g02489 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 66.228 1.53e-110 316.0
Cobi7g02410 . 16 306 Chloroplast and Mitochondria gene family AT2G17270 69.416 8.32e-161 448.0
Cobi7g02278 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 89.179 6.06e-174 478.0
Cobi7g02277 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 9.30e-172 473.0
Cobi7g01685 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.767 1.36e-161 454.0
Cobi7g01572 WGDA 1 187 Chloroplast and Mitochondria gene family AT1G17530 63.102 1.12e-75 223.0
Cobi7g00493 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.558 1.09e-151 421.0
Cobi12g02617 ACH 1 341 Chloroplast and Mitochondria gene family AT5G26200 56.232 8.70e-128 366.0
Cobi4g01418 . 46 548 Chloroplast and Mitochondria gene family AT2G18710 81.018 0.0 827.0
Cobi8g01827 . 45 254 Chloroplast and Mitochondria gene family AT3G61470 94.762 2.92e-150 418.0
Cobi8g02162 . 143 354 Chloroplast and Mitochondria gene family AT2G28800 20.628 1.61e-06 48.5
Cobi4g00312 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.86e-169 467.0
Cobi4g00311 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.12e-168 465.0
Cobi4g00303 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.86e-169 467.0
Cobi4g00302 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.12e-168 465.0
Cobi5g02679 ACH 16 224 Chloroplast and Mitochondria gene family AT5G38630 42.105 4.24e-57 179.0
Cobi5g02568 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.194 2.89e-168 464.0
Cobi2g03860 . 29 354 Chloroplast and Mitochondria gene family AT5G54290 71.865 2.81e-148 421.0
Cobi2g03905 . 29 354 Chloroplast and Mitochondria gene family AT5G54290 71.865 7.11e-148 420.0
Cobih2tg0771l_1g00008 . 64 306 Chloroplast and Mitochondria gene family AT1G25380 26.871 1.61e-28 112.0
Cobih2tg0886l_1g00002 . 87 271 Chloroplast and Mitochondria gene family AT4G03320 41.053 5.00e-43 146.0
Cobi9g01304 . 181 213 Chloroplast and Mitochondria gene family AT2G05100 63.636 1.50e-07 45.4
Cobi9g01777 . 24 111 Chloroplast and Mitochondria gene family AT1G72820 61.364 4.22e-35 120.0
Cobi9g02188 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.143 2.40e-47 159.0
Cobi9g02299 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 63.18 7.28e-108 308.0
Cobi4g03150 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.891 6.36e-168 469.0
Cobi4g01872 . 8 146 Chloroplast and Mitochondria gene family AT1G07020 41.429 4.51e-21 80.9
Cobi4g01699 . 70 347 Chloroplast and Mitochondria gene family AT1G72820 52.5 4.46e-83 249.0
Cobi4g01665 . 1 71 Chloroplast and Mitochondria gene family AT5G05370 70.423 2.93e-35 112.0
Cobi6g02641 WGDA 44 307 Chloroplast and Mitochondria gene family AT3G27240 92.424 9.25e-165 476.0
Cobi8g00023 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 79.225 2.72e-175 488.0
Cobi8g00441 . 24 111 Chloroplast and Mitochondria gene family AT1G72820 60.227 2.83e-34 118.0
Cobi8g01263 ACH 12 236 Chloroplast and Mitochondria gene family AT1G26100 64.53 2.35e-93 272.0