AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Ecan3g02284 ATGGCTGCAGCTCCAAGCTCCACATCTATGGTCAAAGCCACCCCATTCTTGGGTCAAACTAGATCATCTAGCATCAATCCTCTAAGAGATGCTGTCTCTATGCCTAGTGCCAAATTCACCATGAGCAATGACTTGTGGTATGGACCGGACCGTGTTAAGTACTTGGGACCCTTTTCGGCCCAGACCCCGTCTTACTTGACTGGCGAATTCCCCGGTGACTACGGCTGGGACACTGCTGGTTTGTCTGCTGATCCCGAGGCTTTCGCCAAGAACAGGGCTCTTGAGGTTATCCACGGGCGATGGGCTATGCTTGGTGCACTCGGGTGCATCACCCCTGAGGTTCTCGAAAAGTGGGTGAAAGTCGATTTCAAGGAGCCAGTTTGGTTCAAGGCCGGAGCCCAAATTTTCTCTGAAGGTGGTTTGGACTACCTAGGGAACCCGAACCTTGTCCATGCTCAGAGCATATTGGCAGTGCTCGGGTTCCAAGTAATCTTAATGGGCCTTGTTGAGGGCTTCCGTATCAACGGGCTTGACGGAGTTGGAGATGGTAACAACCTATACCCTGGTGGACAATATTTTGACCCATTGGGCCTTGCTGATGACCCGGTAACATTTGCCGAGTTGAAGGTGAAGGAGATCAAGAATGGTAGGCTAGCAATGTTTTCCATGTTTGGGTTCTTTGTGCAAGCAATAGTAACAGGAAAAGGGCCATTGGAGAACTTATTGGACCATTTAGACAACCCTGTAGCTAACAATGCATGGGTCTATGCCACCAAGTTTGTGCCTGGCTCATAG 795 50.19 MAAAPSSTSMVKATPFLGQTRSSSINPLRDAVSMPSAKFTMSNDLWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWVKVDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVILMGLVEGFRINGLDGVGDGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGS 264
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Ecan3g02284 264 Gene3D Chlorophyll a-b binding protein domain 53 257 - -
Ecan3g02284 264 Pfam Chlorophyll A-B binding protein 63 231 IPR022796 -
Ecan3g02284 264 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 9 263 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Ecan3g02284 264 FunFam Chlorophyll a-b binding protein, chloroplastic 53 257 - -
Ecan3g02284 264 SUPERFAMILY Chlorophyll a-b binding protein 45 261 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Ecan3g02284 K08914 light-harvesting complex II chlorophyll a/b binding protein 3
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
84916 Ecan3g02284 Ecan8g02415
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Ecan Ecan-Chr3:33630989 Ecan5g01577 Ecan-Chr5:29558911 dispersed
Ecan Ecan-Chr3:43417188 Ecan3g02284 Ecan-Chr3:33630989 transposed
Ecan Ecan-Chr4:27248763 Ecan3g02284 Ecan-Chr3:33630989 transposed
Ecan Ecan-Chr6:96972 Ecan3g02284 Ecan-Chr3:33630989 transposed
Ecan Ecan-Chr9:8803624 Ecan3g02284 Ecan-Chr3:33630989 transposed
Ecan Ecan-Chr3:33630989 Ecan8g02415 Ecan-Chr8:35619102 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Ecan8g02702 . 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.408 0.0 566.0
Ecan8g02079 ACH 34 257 Chloroplast and Mitochondria gene family AT3G61470 52.679 2.88e-75 227.0
Ecan8g02804 ACH 5 236 Chloroplast and Mitochondria gene family AT1G26100 65.289 1.27e-96 280.0
Ecan8g01531 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 32.143 2.17e-33 123.0
Ecan8g00222 ACH 9 230 Chloroplast and Mitochondria gene family AT5G38630 66.816 8.87e-106 304.0
Ecan8g02415 ACH 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.164 1.68e-121 346.0
Ecan8g02407 . 45 354 Chloroplast and Mitochondria gene family AT5G54290 74.194 6.04e-146 415.0
Ecan8g02284 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 74.387 0.0 555.0
Ecan8g02283 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 64.305 4.69e-164 460.0
Ecan8g03079 . 2 305 Chloroplast and Mitochondria gene family AT2G17270 66.447 8.10e-160 446.0
Ecan8g00542 ACH 30 296 Chloroplast and Mitochondria gene family AT2G47490 37.011 2.51e-46 157.0
Ecan8g03514 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.991 3.84e-150 418.0
Ecan9g00386 . 41 405 Chloroplast and Mitochondria gene family AT2G28800 81.967 0.0 617.0
Ecan9g00907 . 143 345 Chloroplast and Mitochondria gene family AT2G28800 20.0 2.66e-06 47.8
Ecan9g01029 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 27.64 2.80e-32 122.0
Ecan9g00520 ACH 1 326 Chloroplast and Mitochondria gene family AT1G07030 68.328 6.27e-156 438.0
Ecan9g00564 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 65.278 1.69e-33 107.0
Ecan9g00950 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 84.962 3.49e-163 451.0
Ecan9g01006 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.452 1.04e-164 459.0
Ecan1g02801 . 1 187 Chloroplast and Mitochondria gene family AT1G17530 59.788 8.02e-67 201.0
Ecan1g03709 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 32.5 2.30e-34 131.0
Ecan1g03708 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 32.5 2.30e-34 131.0
Ecan1g03710 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 32.624 1.18e-36 132.0
Ecan1g02802 . 5 187 Chloroplast and Mitochondria gene family AT1G17530 61.957 7.49e-68 203.0
Ecan1g03004 . 76 403 Chloroplast and Mitochondria gene family AT2G28800 64.368 8.23e-156 451.0
Ecan1g02418 ACH 2 223 Chloroplast and Mitochondria gene family AT1G14730 58.559 4.25e-88 258.0
Ecan2g03230 ACH 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 2.31e-74 225.0
Ecan2g02871 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 83.154 9.63e-153 426.0
Ecan2g02868 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 83.154 9.63e-153 426.0
Ecan2g02870 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 82.796 1.38e-152 426.0
Ecan2g01768 . 28 300 Chloroplast and Mitochondria gene family AT4G25700 72.34 2.79e-148 417.0
Ecan2g03536 ACH 5 361 Chloroplast and Mitochondria gene family AT5G14040 70.868 0.0 508.0
Ecan2g02867 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 71.071 3.58e-120 342.0
Ecan2g02869 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 71.071 3.58e-120 342.0
Ecan2g03904 . 16 345 Chloroplast and Mitochondria gene family AT1G72820 67.552 6.36e-164 461.0
Ecan2g00667 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.484 0.0 510.0
Ecan2g02295 . 11 320 Chloroplast and Mitochondria gene family AT5G15640 76.129 0.0 502.0
Ecan2g02969 . 51 251 Chloroplast and Mitochondria gene family AT3G61470 50.49 1.89e-62 195.0
Ecan3g02113 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.672 3.61e-168 464.0
Ecan3g02284 ACH 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 3.53e-122 347.0
Ecan3g03597 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 1.79e-172 474.0
Ecan3g00550 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 86.567 1.76e-167 462.0
Ecan3g00549 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 86.567 8.45e-168 462.0
Ecan3g00552 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 86.567 1.30e-167 462.0
Ecan3g00617 . 47 548 Chloroplast and Mitochondria gene family AT2G18710 82.711 0.0 842.0
Ecan1g02423 ACH 18 222 Chloroplast and Mitochondria gene family AT1G14730 44.175 5.02e-57 179.0
Ecan3g02705 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 67.317 1.13e-101 297.0
Ecan3g00547 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 85.448 3.01e-165 456.0
Ecan3g00997 ACH 1 346 Chloroplast and Mitochondria gene family AT1G72820 62.784 2.75e-147 417.0
Ecan3g00980 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 69.444 4.92e-35 111.0
Ecan4g02256 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.783 1.24e-150 419.0
Ecan4g01570 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 1.41e-173 477.0
Ecan4g03284 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.304 7.82e-168 469.0
Ecan4g01745 ACH 4 215 Chloroplast and Mitochondria gene family AT4G25570 44.811 8.69e-60 186.0
Ecan1g01769 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.167 3.43e-147 409.0
Ecan4g01746 ACH 7 216 Chloroplast and Mitochondria gene family AT4G25570 44.762 1.77e-60 187.0
Ecan5g01625 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 89.011 3.10e-172 474.0
Ecan5g01577 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.302 4.58e-180 494.0
Ecan5g01122 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.783 1.12e-151 421.0
Ecan5g00702 ACH 1 347 Chloroplast and Mitochondria gene family AT1G72820 65.994 1.45e-159 448.0
Ecan5g02966 . 2 146 Chloroplast and Mitochondria gene family AT1G07020 46.104 8.68e-28 99.4
Ecan5g01576 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.057 1.88e-176 496.0
Ecan6g03580 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 66.946 5.85e-114 324.0
Ecan6g03290 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 25.566 1.23e-28 112.0
Ecan6g01400 . 37 303 Chloroplast and Mitochondria gene family AT1G25380 29.293 3.08e-13 67.8
Ecan6g02380 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.342 0.0 509.0
Ecan6g01816 ACH 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.193 1.83e-48 163.0
Ecan6g01669 . 7 304 Chloroplast and Mitochondria gene family AT2G17270 67.45 4.00e-154 432.0
Ecan6g02100 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 69.737 6.38e-119 336.0
Ecan6g00011 . 23 327 Chloroplast and Mitochondria gene family AT1G76570 74.754 7.65e-177 491.0
Ecan1g01053 . 45 271 Chloroplast and Mitochondria gene family AT4G03320 35.776 1.29e-43 148.0
Ecan1g02577 . 12 313 Chloroplast and Mitochondria gene family AT1G25380 68.197 3.20e-140 400.0
Ecan7g02887 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.672 7.49e-166 460.0
Ecan7g00384 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 76.099 0.0 548.0