AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Enbr6g02077 ATGGCTGCAGCTCCAAGCTCCACATCTGTGGTCAAAGCCACCCCATTCTTGGGTCAAACTAGATCATCTAGCACCAATCCTCTAAGAGATGCTGTCTCTATGCCTAGTGCCAAATTCACCATGAGCAATGACTTGTGGTATGGACCGGACCGTGTTAAGTACTTGGAACCCTTTTCGGCCCAGACCCCGTCTTACTTGACTGGCGAATTCCCCGGTGACTACGGCTGGGACACTGCTGGTTTGTCTGCTGATCCCGAGGCTTTCGCTAAGAACAGGGCTCTTGAGGTTATCCACGGGATATGGGCTATGCTTGGTGCACTCGGGTGCATCACTCCCGAGAGCATATTGGCGGTGCTCGGGTTCCAAGTAATCATGATGGGCCTTGTTGAGGGGTTCCGTATCAACGGGCTTGACGGAGTTGGAGATGGTAACAACCTATACCCTGGTGGACAATATTTCGACCCATTGGGCCTTGCTGATGACCCGGTAACATTTGCCGAGTTGAAGGTGAAGGAGATCAAGAATGGTAGGCTAGCAATGTTTTCCATGTTTGGGTTCTTTGTGCAAGCAATAGTAACAGGAAAAGGGCCATTGGAGAACTTGTTGGACCATTTGGACAACCCTGTAGCTAACAATGCATGGGTCTATGCCACCAAGTTTGTGCCTGGCTCATAG 675 50.67 MAAAPSSTSVVKATPFLGQTRSSSTNPLRDAVSMPSAKFTMSNDLWYGPDRVKYLEPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGIWAMLGALGCITPESILAVLGFQVIMMGLVEGFRINGLDGVGDGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGS 224
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Enbr6g02077 224 Pfam Chlorophyll A-B binding protein 63 191 IPR022796 -
Enbr6g02077 224 Gene3D Chlorophyll a-b binding protein domain 116 217 - -
Enbr6g02077 224 Gene3D Chlorophyll a-b binding protein domain 53 115 - -
Enbr6g02077 224 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 113 223 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Enbr6g02077 224 SUPERFAMILY Chlorophyll a-b binding protein 45 221 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Enbr6g02077 - -
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Enbr Enbr-Chr1:275213776 Enbr6g02077 Enbr-Chr6:73324436 dispersed
Enbr Enbr-Chr1:275245911 Enbr6g02077 Enbr-Chr6:73324436 dispersed
Enbr Enbr-Chr6:73324436 Enbr8g02053 Enbr-Chr8:69330987 dispersed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Enbr1g01939 . 143 354 Chloroplast and Mitochondria gene family AT2G28800 20.091 1.05e-06 48.9
Enbr1g04614 . 1 367 Chloroplast and Mitochondria gene family AT5G14040 67.575 2.61e-172 482.0
Enbr1g04155 . 76 403 Chloroplast and Mitochondria gene family AT2G28800 63.037 7.36e-155 448.0
Enbr1g09011 . 2 108 Chloroplast and Mitochondria gene family AT5G14040 51.852 1.30e-26 99.0
Enbr1g09012 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 75.871 0.0 563.0
Enbr7g00042 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.672 7.32e-166 460.0
Enbr1g04772 . 472 517 Chloroplast and Mitochondria gene family AT4G21490 67.391 2.34e-17 73.2
Enbr5g01931 ACH 1 71 Chloroplast and Mitochondria gene family AT5G05370 67.606 1.52e-33 108.0
Enbr5g02434 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 27.95 1.51e-33 125.0
Enbr3g01789 ACH 5 372 Chloroplast and Mitochondria gene family AT5G14040 76.423 0.0 567.0
Enbr3g01075 ACH 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.193 1.69e-48 163.0
Enbr1g03017 . 5 236 Chloroplast and Mitochondria gene family AT1G26100 65.289 1.23e-95 278.0
Enbr2g01282 . 314 364 Chloroplast and Mitochondria gene family AT5G14040 86.275 3.36e-25 93.2
Enbr2g00436 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.161 0.0 508.0
Enbr1g06185 . 153 284 Chloroplast and Mitochondria gene family AT1G76570 87.879 1.64e-82 246.0
Enbr1g00356 . 33 315 Chloroplast and Mitochondria gene family AT1G25380 59.406 8.88e-115 336.0
Enbr2g03642 . 17 305 Chloroplast and Mitochondria gene family AT2G17270 69.55 1.96e-158 442.0
Enbr1g00236 ACH 1 71 Chloroplast and Mitochondria gene family AT5G05370 69.014 3.27e-33 110.0
Enbr1g08877 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.164 4.54e-121 345.0
Enbr1g03717 . 12 327 Chloroplast and Mitochondria gene family AT1G25380 64.486 7.84e-139 397.0
Enbr2g01780 . 28 300 Chloroplast and Mitochondria gene family AT4G25700 72.695 6.65e-149 418.0
Enbr4g03804 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.783 1.24e-150 419.0
Enbr1g09635 . 199 240 Chloroplast and Mitochondria gene family AT2G28800 71.429 4.74e-14 70.9
Enbr1g08887 . 46 354 Chloroplast and Mitochondria gene family AT5G54290 74.757 4.34e-146 414.0
Enbr7g01985 . 181 211 Chloroplast and Mitochondria gene family AT5G40810 67.742 1.03e-10 52.8
Enbr2g00105 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 83.871 4.24e-154 429.0
Enbr2g00104 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 84.286 4.04e-152 424.0
Enbr1g07695 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 66.829 2.84e-101 294.0
Enbr3g00520 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 25.566 1.32e-28 112.0
Enbr9g00742 ACH 30 296 Chloroplast and Mitochondria gene family AT2G47490 37.011 1.00e-45 155.0
Enbr3g03227 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 67.364 2.57e-114 325.0
Enbr2g04816 . 70 361 Chloroplast and Mitochondria gene family AT5G14040 79.452 1.95e-178 496.0
Enbr3g01750 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.342 0.0 509.0
Enbr5g03592 . 48 148 Chloroplast and Mitochondria gene family AT5G15640 74.257 1.72e-45 155.0
Enbr5g03588 . 143 345 Chloroplast and Mitochondria gene family AT2G28800 20.0 7.54e-06 45.8
Enbr3g00494 . 37 327 Chloroplast and Mitochondria gene family AT1G76570 76.976 2.12e-175 487.0
Enbr5g03939 . 1 164 Chloroplast and Mitochondria gene family AT2G34430 57.143 5.35e-65 199.0
Enbr5g03940 . 44 137 Chloroplast and Mitochondria gene family AT1G29910 70.213 4.94e-41 134.0
Enbr6g01699 . 104 261 Chloroplast and Mitochondria gene family AT1G76570 82.911 7.36e-97 281.0
Enbr1g04998 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 30.619 2.74e-33 128.0
Enbr7g00358 . 1 356 Chloroplast and Mitochondria gene family AT5G14040 75.281 0.0 536.0
Enbr4g00694 . 1 325 Chloroplast and Mitochondria gene family AT1G07030 69.118 5.35e-157 441.0
Enbr8g00160 . 2 146 Chloroplast and Mitochondria gene family AT1G07020 42.308 3.69e-24 90.1
Enbr5g01530 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.395 5.49e-152 422.0
Enbr8g01853 . 104 294 Chloroplast and Mitochondria gene family AT1G76570 80.105 3.02e-113 329.0
Enbr5g02339 . 270 307 Chloroplast and Mitochondria gene family AT3G27240 92.105 1.31e-11 59.7
Enbr2g04529 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 2.11e-74 225.0
Enbr2g01339 . 92 272 Chloroplast and Mitochondria gene family AT5G40810 93.923 1.79e-119 342.0
Enbr6g01726 . 70 273 Chloroplast and Mitochondria gene family AT1G61520 91.667 4.20e-139 389.0
Enbr3g00387 . 7 304 Chloroplast and Mitochondria gene family AT2G17270 66.779 5.13e-151 424.0
Enbr3g00960 . 106 197 Chloroplast and Mitochondria gene family AT1G76570 78.261 5.00e-50 164.0
Enbr8g02054 . 1 68 Chloroplast and Mitochondria gene family AT2G05100 73.529 3.48e-30 104.0
Enbr8g02053 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.302 1.58e-179 492.0
Enbr1g07063 . 109 222 Chloroplast and Mitochondria gene family AT1G14730 35.088 8.73e-13 61.6
Enbr1g07065 . 18 134 Chloroplast and Mitochondria gene family AT1G14730 63.115 2.46e-40 147.0
Enbr5g02415 . 8 307 Chloroplast and Mitochondria gene family AT2G47490 78.667 6.45e-164 458.0
Enbr4g00819 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 31.786 7.13e-33 122.0
Enbr1g08378 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 87.387 8.53e-141 394.0
Enbr1g08381 . 34 254 Chloroplast and Mitochondria gene family AT3G61470 90.95 4.52e-149 417.0
Enbr6g00362 . 104 284 Chloroplast and Mitochondria gene family AT1G76570 76.243 6.79e-98 284.0
Enbr6g01966 . 49 548 Chloroplast and Mitochondria gene family AT2G18710 83.629 0.0 846.0
Enbr8g00699 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 89.011 8.31e-172 473.0
Enbr5g04036 . 41 405 Chloroplast and Mitochondria gene family AT2G28800 81.967 0.0 613.0
Enbr6g02077 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 55.263 3.98e-91 267.0
Enbr1g02719 . 163 209 Chloroplast and Mitochondria gene family AT5G40810 62.5 4.53e-12 57.4
Enbr7g00356 . 173 314 Chloroplast and Mitochondria gene family AT5G14040 83.803 1.41e-84 250.0
Enbr4g02671 . 4 215 Chloroplast and Mitochondria gene family AT4G25570 43.868 2.75e-58 182.0
Enbr4g02670 . 115 224 Chloroplast and Mitochondria gene family AT5G38630 45.455 4.79e-29 102.0
Enbr4g02697 . 34 257 Chloroplast and Mitochondria gene family AT3G61470 52.679 1.79e-75 228.0
Enbr6g01510 . 168 219 Chloroplast and Mitochondria gene family AT2G05100 75.0 1.68e-23 88.2
Enbr7g00337 . 314 364 Chloroplast and Mitochondria gene family AT5G14040 86.275 5.11e-25 92.4
Enbr7g00338 . 314 364 Chloroplast and Mitochondria gene family AT5G14040 82.353 4.36e-23 87.4
Enbr2g01179 . 153 284 Chloroplast and Mitochondria gene family AT1G76570 88.636 1.15e-83 248.0
Enbr4g02202 . 270 307 Chloroplast and Mitochondria gene family AT3G27240 92.105 6.27e-11 59.3
Enbr3g00160 . 47 228 Chloroplast and Mitochondria gene family AT5G38630 69.78 1.04e-94 273.0
Enbr7g02902 . 1 57 Chloroplast and Mitochondria gene family AT5G05370 64.912 2.65e-24 87.4
Enbr7g03572 . 45 270 Chloroplast and Mitochondria gene family AT4G03320 36.752 4.24e-44 148.0
Enbr1g01325 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.167 3.43e-147 409.0
Enbr3g04520 . 1 164 Chloroplast and Mitochondria gene family AT2G34430 57.143 5.35e-65 199.0
Enbr9g00940 . 153 284 Chloroplast and Mitochondria gene family AT1G76570 87.879 3.82e-82 248.0
Enbr4g02012 . 150 233 Chloroplast and Mitochondria gene family AT5G14040 52.326 7.34e-20 82.4
Enbr1g08882 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.164 4.54e-121 345.0
Enbr2g00357 . 104 284 Chloroplast and Mitochondria gene family AT1G76570 79.558 1.11e-104 303.0
Enbr5g01964 . 1 325 Chloroplast and Mitochondria gene family AT1G07030 69.118 5.35e-157 441.0
Enbr6g03343 . 9 66 Chloroplast and Mitochondria gene family AT5G38630 64.407 1.01e-19 77.4
Enbr9g00739 . 30 296 Chloroplast and Mitochondria gene family AT2G47490 37.011 1.00e-45 155.0
Enbr7g01996 . 181 211 Chloroplast and Mitochondria gene family AT5G40810 67.742 1.03e-10 52.8
Enbr7g00340 . 314 364 Chloroplast and Mitochondria gene family AT5G14040 86.275 5.11e-25 92.4
Enbr2g00809 . 73 223 Chloroplast and Mitochondria gene family AT1G14730 58.278 1.95e-56 174.0
Enbr1g09411 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.167 3.43e-147 409.0
Enbr6g00900 . 70 273 Chloroplast and Mitochondria gene family AT1G61520 91.667 2.52e-139 389.0
Enbr3g01457 . 37 303 Chloroplast and Mitochondria gene family AT1G25380 28.713 6.76e-13 66.6