AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Eupl14g01247 ATGACTTACCCCTTCCTTGGAGCCATTGGGAGGTTGCCCAGCTGGTTCTTGATGGCATATTTTTTTGCTTTATATCTCGGAGTGGTGAGGAAGAAGGAATGGCCCCACTTCTTCAGGTTCCATGTCGTGATGGGCATGCTCCTTGAAATTGCCCTCCAGGTGATCGGGACAGTGAGCCGTTGGATGCCACTGGCTGTGTATTGGGGAAAGATTGGCATGCACTTCTGGACGGCAGTCTCATTTGCATACCTGTTTACAGTGCTTGAATGCATACGGTGTGCTCTTGGGGGCATGTATGCGGACATCCCTTTTGTACGTGATGCTGCTTATATCCAAATTCCTTATGATTAA 351 48.72 MTYPFLGAIGRLPSWFLMAYFFALYLGVVRKKEWPHFFRFHVVMGMLLEIALQVIGTVSRWMPLAVYWGKIGMHFWTAVSFAYLFTVLECIRCALGGMYADIPFVRDAAYIQIPYD 116
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Eupl14g01247 116 PANTHER PROTEIN TIC 20-II, CHLOROPLASTIC 1 116 IPR005691 -
Eupl14g01247 116 Pfam Chloroplast import apparatus Tic20-like 1 109 IPR005691 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Eupl14g01247 - -
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Eupl11g00202 . 32 252 Chloroplast and Mitochondria gene family AT3G61470 88.688 1.32e-144 405.0
Eupl11g00103 . 2 367 Chloroplast and Mitochondria gene family AT5G14040 77.322 0.0 580.0
Eupl11g01258 . 33 363 Chloroplast and Mitochondria gene family AT1G25380 65.487 5.04e-154 436.0
Eupl11g00949 . 1 317 Chloroplast and Mitochondria gene family AT5G15640 74.448 1.01e-176 490.0
Eupl11g00785 . 55 254 Chloroplast and Mitochondria gene family AT3G61470 56.0 2.10e-75 228.0
Eupl6g00821 . 55 392 Chloroplast and Mitochondria gene family AT4G21490 41.57 2.81e-70 234.0
Eupl6g00790 . 5 354 Chloroplast and Mitochondria gene family AT5G54290 70.423 9.26e-153 432.0
Eupl6g00776 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 67.669 1.52e-124 353.0
Eupl3g00052 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.929 6.49e-153 427.0
Eupl4g01492 . 1 236 Chloroplast and Mitochondria gene family AT1G26100 67.755 1.79e-102 298.0
Eupl4g01493 . 1 226 Chloroplast and Mitochondria gene family AT5G38630 70.485 4.48e-118 334.0
Eupl2g00143 . 1 580 Chloroplast and Mitochondria gene family AT4G21490 72.384 0.0 875.0
Eupl3g00635 . 72 116 Chloroplast and Mitochondria gene family AT2G18710 55.556 2.18e-09 54.7
Eupl8g00618 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 66.527 1.16e-109 313.0
Eupl8g00488 . 45 297 Chloroplast and Mitochondria gene family AT4G25700 79.134 5.43e-149 419.0
Eupl2g00154 . 1 580 Chloroplast and Mitochondria gene family AT4G21490 72.727 0.0 877.0
Eupl1g01537 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 85.892 7.92e-147 408.0
Eupl13g01934 . 12 301 Chloroplast and Mitochondria gene family AT2G47490 26.11 9.64e-28 109.0
Eupl13g01920 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.63 1.19e-155 434.0
Eupl13g01670 . 4 258 Chloroplast and Mitochondria gene family AT1G15820 79.377 6.40e-147 409.0
Eupl4g01870 . 4 214 Chloroplast and Mitochondria gene family AT4G25570 46.698 4.82e-66 202.0
Eupl4g01869 . 1 110 Chloroplast and Mitochondria gene family AT1G14730 45.045 1.55e-26 96.7
Eupl4g01103 . 41 255 Chloroplast and Mitochondria gene family AT3G61470 53.488 2.53e-76 230.0
Eupl4g00452 . 43 407 Chloroplast and Mitochondria gene family AT2G28800 60.982 1.01e-155 452.0
Eupl4g00380 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.645 0.0 518.0
Eupl4g00289 . 32 253 Chloroplast and Mitochondria gene family AT3G61470 86.486 3.46e-143 400.0
Eupl4g00160 . 2 365 Chloroplast and Mitochondria gene family AT5G14040 81.868 0.0 604.0
Eupl6g01314 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 89.925 1.07e-177 488.0
Eupl6g01315 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 89.552 7.76e-177 486.0
Eupl6g00066 . 187 250 Chloroplast and Mitochondria gene family AT1G61520 85.938 1.36e-32 112.0
Eupl6g00262 . 1 48 Chloroplast and Mitochondria gene family AT2G05100 79.167 8.08e-19 75.1
Eupl4g01652 . 33 313 Chloroplast and Mitochondria gene family AT1G25380 70.07 3.16e-145 411.0
Eupl9g00633 . 50 255 Chloroplast and Mitochondria gene family AT3G61470 67.476 5.23e-103 298.0
Eupl9g00527 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 75.652 0.0 525.0
Eupl1g00933 . 11 187 Chloroplast and Mitochondria gene family AT1G17530 61.582 2.03e-67 202.0
Eupl1g00982 . 9 316 Chloroplast and Mitochondria gene family AT1G07030 73.163 4.23e-163 456.0
Eupl1g01094 . 14 289 Chloroplast and Mitochondria gene family AT5G01530 83.333 5.86e-164 455.0
Eupl1g01276 . 161 376 Chloroplast and Mitochondria gene family AT4G21490 25.778 1.40e-06 48.5
Eupl8g00322 . 143 354 Chloroplast and Mitochondria gene family AT2G28800 21.461 2.17e-08 54.3
Eupl8g00480 . 1 257 Chloroplast and Mitochondria gene family AT5G52570 67.407 5.44e-121 350.0
Eupl13g00819 . 1 308 Chloroplast and Mitochondria gene family AT2G17270 70.13 2.69e-168 468.0
Eupl13g00858 . 28 327 Chloroplast and Mitochondria gene family AT1G76570 79.402 0.0 513.0
Eupl3g01451 . 4 258 Chloroplast and Mitochondria gene family AT1G15820 80.309 2.17e-148 413.0
Eupl10g01175 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 77.391 0.0 546.0
Eupl14g00202 . 143 354 Chloroplast and Mitochondria gene family AT2G28800 24.215 9.70e-11 61.6
Eupl14g00311 . 31 319 Chloroplast and Mitochondria gene family AT1G07030 63.636 2.58e-121 350.0
Eupl14g00352 . 1 297 Chloroplast and Mitochondria gene family AT4G25700 64.537 4.47e-143 404.0
Eupl14g00480 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 67.782 1.03e-110 316.0
Eupl14g00481 . 1 218 Chloroplast and Mitochondria gene family AT4G25570 62.557 1.30e-90 265.0
Eupl5g01295 . 120 405 Chloroplast and Mitochondria gene family AT2G28800 88.462 0.0 530.0
Eupl5g01545 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 85.892 6.99e-146 405.0
Eupl5g02046 . 37 322 Chloroplast and Mitochondria gene family AT1G25380 25.538 2.20e-29 114.0
Eupl5g02228 . 9 324 Chloroplast and Mitochondria gene family AT1G07030 74.688 5.78e-172 478.0
Eupl5g02230 . 50 143 Chloroplast and Mitochondria gene family AT1G07020 55.789 1.12e-23 89.0
Eupl5g02299 . 6 187 Chloroplast and Mitochondria gene family AT1G17530 60.44 6.06e-68 203.0
Eupl5g02414 . 1 56 Chloroplast and Mitochondria gene family AT3G10860 85.714 9.47e-34 108.0
Eupl3g01999 . 33 300 Chloroplast and Mitochondria gene family AT2G47490 35.39 7.78e-43 149.0
Eupl9g01112 . 42 551 Chloroplast and Mitochondria gene family AT2G18710 83.922 0.0 865.0
Eupl1g01744 . 37 405 Chloroplast and Mitochondria gene family AT2G28800 79.679 0.0 612.0
Eupl14g00515 . 1 218 Chloroplast and Mitochondria gene family AT4G25570 64.384 6.27e-93 270.0
Eupl14g00514 . 49 212 Chloroplast and Mitochondria gene family AT4G25570 74.39 1.70e-83 248.0
Eupl7g01065 . 33 310 Chloroplast and Mitochondria gene family AT1G25380 28.713 7.95e-14 69.7
Eupl7g01468 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 79.612 2.33e-174 483.0
Eupl3g00012 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.929 6.49e-153 427.0
Eupl2g00738 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 84.058 1.16e-160 445.0
Eupl11g01445 . 67 226 Chloroplast and Mitochondria gene family AT5G38630 72.5 1.78e-87 254.0
Eupl14g01246 . 96 139 Chloroplast and Mitochondria gene family AT4G03320 45.455 8.33e-08 48.5
Eupl14g01247 . 160 275 Chloroplast and Mitochondria gene family AT4G03320 51.724 6.16e-36 122.0
Eupl12g01297 . 11 318 Chloroplast and Mitochondria gene family AT5G15640 52.751 1.56e-117 340.0
Eupl12g01177 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.129 0.0 512.0
Eupl12g00950 . 209 305 Chloroplast and Mitochondria gene family AT2G47490 82.474 2.14e-57 177.0
Eupl12g00949 . 1 202 Chloroplast and Mitochondria gene family AT2G47490 78.922 8.79e-105 302.0
Eupl12g00829 . 33 310 Chloroplast and Mitochondria gene family AT1G25380 29.139 7.99e-15 72.4
Eupl4g01879 . 4 214 Chloroplast and Mitochondria gene family AT4G25570 47.642 1.15e-67 206.0
Eupl4g01876 . 1 138 Chloroplast and Mitochondria gene family AT1G14730 46.043 6.12e-38 126.0