AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Fli1g02280 ATGGCTTTCACCATTGCTTCCACCTCCCATTCATCCCTCCCAACAAGGGGAGAATTCATCACAAGACTACCTTCTGCAGAAAGGAGTTGTACTCCGAGGTACATGTTCAGAAGCACCCATGGAGTACAGAAGCTCAAAGCAGCTAAAGAAGGTGTATCAAGTGTCTGTGAACCACTTCCTGCAGATAGACCAGTTTGGTTCCCAGGAACCTCACCTCCTGAATGGCTAGATGGAAGCCTCCCTGGAGATTTTGGCTTTGACCCACTTGGATTAGGGTCTGATCCTGAATTACTTAAGTGGTTTGCACAAGCTGAGTTGATGCACAGCAGATGGGCAATGCTTGCAGTTGCTGGTATTTTGATACCAGAATGGCTGGAAAGTATGGGCTTTATCGATGATTTCTCGTGGTTCGAAGCGGGCTCTAGAGAGTACTTTGCGGATCCGACGACTTTATTCGTGGTGCAAATGGCGTTGATGGGTTGGGTGGAGGGTCGAAGATGGGCTGACATAATCAACCCTGGGTGCGTTGACATCGAGCCTAATCTTCCTAATAAGAAGAAACCAAAGCCCGATGTTGGATACCCAGGGGGATTGTGGTTTGACCCGTTCATGTGGGGAAGAGGGTCCCCAGAACCAGTGATGGTTCTGAGGACCAAAGAGATAAAGAATGGGCGGCTAGCCATGTTGGCTTTTGCGGGTTTTGTGTTCCAAGCCATTTACACAGGGAAAGGACCCCTTGAGAACCTATCGGCTCACCTCGCGGACCCTGGTCATGTCAACATTTTCTCGGCCTTCAGCACCCAAATTCAATGA 813 49.32 MAFTIASTSHSSLPTRGEFITRLPSAERSCTPRYMFRSTHGVQKLKAAKEGVSSVCEPLPADRPVWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWLESMGFIDDFSWFEAGSREYFADPTTLFVVQMALMGWVEGRRWADIINPGCVDIEPNLPNKKKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFAGFVFQAIYTGKGPLENLSAHLADPGHVNIFSAFSTQIQ 270
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Fli1g02280 270 SUPERFAMILY Chlorophyll a-b binding protein 62 265 - -
Fli1g02280 270 Pfam Chlorophyll A-B binding protein 72 239 IPR022796 -
Fli1g02280 270 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 42 262 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Fli1g02280 270 FunFam Chlorophyll a-b binding protein, chloroplastic 73 258 - -
Fli1g02280 270 Gene3D Chlorophyll a-b binding protein domain 73 258 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Fli1g02280 K08908 light-harvesting complex I chlorophyll a/b binding protein 2
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Fli Fli-Chr14:10739724 Fli1g02280 Fli-Chr1:104547537 dispersed
Fli Fli-Chr15:25719724 Fli1g02280 Fli-Chr1:104547537 dispersed
Fli Fli-Chr17:18431344 Fli1g02280 Fli-Chr1:104547537 dispersed
Fli Fli-Chr17:18643147 Fli1g02280 Fli-Chr1:104547537 dispersed
Fli Fli-Chr1:104547537 Fli2g00753 Fli-Chr2:12972514 dispersed
Fli Fli-Chr1:104547537 Fli12g01696 Fli-Chr12:66625736 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Fli1g01170 . 7 143 Chloroplast and Mitochondria gene family AT1G07020 44.928 1.00e-24 91.7
Fli1g01379 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 4.73e-34 109.0
Fli1g01835 . 51 127 Chloroplast and Mitochondria gene family AT2G28800 59.259 2.88e-21 85.9
Fli1g02280 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 66.667 4.35e-101 293.0
Fli1g03008 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.567 3.21e-170 469.0
Fli2g00045 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.049 1.49e-171 479.0
Fli2g00295 ACH 1 361 Chloroplast and Mitochondria gene family AT5G14040 69.972 1.33e-179 501.0
Fli2g00753 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.606 6.56e-61 191.0
Fli2g00848 WGDA 52 91 Chloroplast and Mitochondria gene family AT4G10340 82.5 5.93e-19 76.3
Fli2g00849 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.392 1.64e-154 431.0
Fli2g01234 WGDA 7 320 Chloroplast and Mitochondria gene family AT5G15640 71.975 1.20e-174 484.0
Fli2g01235 WGDA 12 320 Chloroplast and Mitochondria gene family AT5G15640 76.375 9.40e-180 498.0
Fli2g01708 . 1 297 Chloroplast and Mitochondria gene family AT2G17270 68.687 2.10e-160 447.0
Fli2g01926 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.075 0.0 564.0
Fli2g02715 . 51 127 Chloroplast and Mitochondria gene family AT2G28800 60.494 5.92e-22 87.8
Fli3g00236 . 51 405 Chloroplast and Mitochondria gene family AT2G28800 81.894 0.0 594.0
Fli3g00837 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.623 3.84e-166 462.0
Fli3g00858 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.398 3.68e-31 119.0
Fli4g01323 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.302 1.07e-178 490.0
Fli5g00276 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 59.821 7.82e-91 265.0
Fli5g00277 . 19 224 Chloroplast and Mitochondria gene family AT1G14730 44.175 8.86e-60 186.0
Fli5g00653 . 76 407 Chloroplast and Mitochondria gene family AT2G28800 62.429 6.14e-151 439.0
Fli5g02515 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.577 1.45e-161 449.0
Fli6g00022 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 78.521 6.96e-175 485.0
Fli6g01339 WGDA 29 271 Chloroplast and Mitochondria gene family AT2G47490 35.156 3.75e-35 127.0
Fli6g01696 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.839 0.0 506.0
Fli6g02429 . 1 209 Chloroplast and Mitochondria gene family AT4G25570 69.856 8.10e-108 308.0
Fli7g00139 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 73.626 0.0 546.0
Fli8g00010 . 148 287 Chloroplast and Mitochondria gene family AT5G01530 39.726 1.04e-19 80.5
Fli8g00652 . 1 105 Chloroplast and Mitochondria gene family AT5G14040 43.81 3.40e-18 75.9
Fli9g00386 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 1.65e-171 472.0
Fli9g01159 . 250 288 Chloroplast and Mitochondria gene family AT5G01530 74.359 1.17e-15 65.5
Fli9g01220 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.91e-31 102.0
Fli9g01240 . 1 325 Chloroplast and Mitochondria gene family AT2G30160 70.732 1.55e-163 457.0
Fli10g00404 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.304 5.49e-171 478.0
Fli10g01119 . 2 258 Chloroplast and Mitochondria gene family AT1G15820 81.712 1.15e-150 419.0
Fli10g01419 . 139 266 Chloroplast and Mitochondria gene family AT2G34430 89.062 2.71e-76 226.0
Fli10g01420 . 1 108 Chloroplast and Mitochondria gene family AT1G29930 72.222 2.45e-48 153.0
Fli10g01421 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 8.03e-169 465.0
Fli11g01872 WGDA 47 75 Chloroplast and Mitochondria gene family AT3G54890 68.966 3.14e-08 47.0
Fli11g01876 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 4.15e-76 229.0
Fli11g02113 . 33 354 Chloroplast and Mitochondria gene family AT5G54290 72.671 4.38e-146 415.0
Fli12g01289 . 84 345 Chloroplast and Mitochondria gene family AT2G28800 20.567 4.90e-06 47.0
Fli12g01696 WGDA 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.541 4.53e-150 418.0
Fli12g02179 . 7 236 Chloroplast and Mitochondria gene family AT1G26100 61.983 3.18e-89 262.0
Fli13g00212 . 33 290 Chloroplast and Mitochondria gene family AT2G47490 28.621 3.22e-27 107.0
Fli13g00604 ACH 5 373 Chloroplast and Mitochondria gene family AT5G14040 76.423 0.0 577.0
Fli13g00634 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.839 0.0 507.0
Fli13g00996 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 38.246 5.04e-50 166.0
Fli14g00479 WGDA 4 295 Chloroplast and Mitochondria gene family AT4G21490 65.306 6.28e-133 387.0
Fli14g00605 ACH,WGDA 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 8.02e-151 419.0
Fli14g01622 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.914 3.21e-122 347.0
Fli14g01623 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.914 3.21e-122 347.0
Fli15g00487 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 61.413 6.20e-70 209.0
Fli15g00843 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.609 1.59e-149 416.0
Fli15g01158 ACH,WGDA 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.583 8.24e-146 405.0
Fli15g01160 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.583 8.24e-146 405.0
Fli15g01217 . 37 318 Chloroplast and Mitochondria gene family AT1G07030 32.042 1.30e-32 121.0
Fli15g01546 . 12 210 Chloroplast and Mitochondria gene family AT1G25380 66.667 1.02e-79 241.0
Fli15g01552 . 33 327 Chloroplast and Mitochondria gene family AT1G25380 65.0 1.50e-139 398.0
Fli16g00352 . 5 300 Chloroplast and Mitochondria gene family AT4G25700 65.798 3.05e-141 399.0
Fli16g00646 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.319 0.0 517.0
Fli16g01104 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 81.915 6.86e-151 422.0
Fli16g01608 . 35 307 Chloroplast and Mitochondria gene family AT5G40810 89.781 3.62e-172 478.0
Fli16g01649 . 35 307 Chloroplast and Mitochondria gene family AT5G40810 89.781 3.62e-172 478.0
Fli17g00112 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 33.214 1.16e-34 127.0
Fli17g00262 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 5.23e-122 347.0
Fli17g00477 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 7.24e-76 229.0
Fli17g00481 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 7.24e-76 229.0
Fli18g00610 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 8.65e-180 493.0
Fli18g00649 . 8 147 Chloroplast and Mitochondria gene family AT1G07020 36.667 2.16e-14 65.1
Fli10001013.1g00002 . 1 99 Chloroplast and Mitochondria gene family AT1G72820 69.697 7.89e-46 149.0
Fli10001013.1g00003 . 256 343 Chloroplast and Mitochondria gene family AT1G72820 73.864 1.69e-39 132.0
Fli10000125.1g00001 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.194 2.52e-168 464.0
Fli10000125.1g00002 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 3.43e-171 471.0
Fli10001030.1g00002 . 41 270 Chloroplast and Mitochondria gene family AT4G03320 37.449 3.43e-45 152.0
Fli10000030.1g00007 . 1 228 Chloroplast and Mitochondria gene family AT5G14040 63.596 3.29e-98 288.0
Fli10001298.1g00004 . 224 265 Chloroplast and Mitochondria gene family AT2G05070 95.238 3.09e-24 88.2