AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Fli3g00837 ATGGCCGCTGATGCCTACGCCCCCACTTCGTTCCCGATTCTCTGTAATGCTGCTGCTGGTGCTTCCGCTGGGGTTATTGCGGCTACATTTGTTTGTCCTTTAGATGTGATCAAGACTAGGTTTCAGGTTCATGGTCTTCCGCAGCTTAACGGTGGAACCGTGAAAGGTAGTCTTATAGTAGGTAGCTTAGAACAGATTTTTCGGAAGGAAGGGGTGCGCGGGTTGTACCGTGGGCTTTCTCCTACTATTCTTGCCTTGCTTCCAAACTGGGCGGTTTATTTTACTATCTACGAGCAGCTCAAAGGTCTGCTTGGCTCTGATGGAATTCATGGCCTGTCTTTTGGTGCCAATATGGTAGCTGCTTCAGGGGCTGGAGCTGCAACGACCATTGTGACAAATCCTTTGTGGGTTGTGAAGACAAGGCTACAAACTCAAGGAATGAGAACAGGCCTGATACCATATAGGGGTACGCTATCAGCTTTGAGGAAAATTGCTCATGAAGAGGGTATTCGTGGCTTATACAGTGGTCTAGTACCTGCACTGGTGGGCATTAGTCATGTTGCAATCCAATTTCCAGCTTATGAGAAGATTAAAATCTATTTGGCTAGTAGAGAGGGTACCACAGCTGATAAACTTGGTGCTCGTGATGTCGCTGTTGCTTCTTCCGTATCAAAAATATTTGCATCCACTTTAACATATCCACACGAGGTTGTTAGGTCAAGGCTGCAAGAACAAGGGCACCATTCTGAAAAGAGGTACTCGGGAATGGTTGATTGCATAAAGAAATTATTTGCAAAAGAAGGGCTTCCTGGGTTCTACCGCGGTTGTGCTACTAACCTGTTCAGGACAACCCCTGCTGCTGTTATAACATTTACCAGCTTTGAAATGATTCACCGGTTTCTCGTCACTTTATTCCCTTCTGACCCTCAACCTCACACATTATGA 945 46.14 MAADAYAPTSFPILCNAAAGASAGVIAATFVCPLDVIKTRFQVHGLPQLNGGTVKGSLIVGSLEQIFRKEGVRGLYRGLSPTILALLPNWAVYFTIYEQLKGLLGSDGIHGLSFGANMVAASGAGAATTIVTNPLWVVKTRLQTQGMRTGLIPYRGTLSALRKIAHEEGIRGLYSGLVPALVGISHVAIQFPAYEKIKIYLASREGTTADKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYSGMVDCIKKLFAKEGLPGFYRGCATNLFRTTPAAVITFTSFEMIHRFLVTLFPSDPQPHTL 314
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Fli3g00837 314 PRINTS Mitochondrial carrier protein signature 16 29 IPR002067 GO:0055085(InterPro)
Fli3g00837 314 PRINTS Mitochondrial carrier protein signature 127 145 IPR002067 GO:0055085(InterPro)
Fli3g00837 314 PRINTS Mitochondrial carrier protein signature 29 43 IPR002067 GO:0055085(InterPro)
Fli3g00837 314 PRINTS Mitochondrial carrier protein signature 78 98 IPR002067 GO:0055085(InterPro)
Fli3g00837 314 PRINTS Mitochondrial carrier protein signature 221 243 IPR002067 GO:0055085(InterPro)
Fli3g00837 314 SUPERFAMILY Mitochondrial carrier 11 296 IPR023395 -
Fli3g00837 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 112 200 IPR018108 -
Fli3g00837 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 212 300 IPR018108 -
Fli3g00837 314 Gene3D Mitochondrial carrier domain 3 108 IPR023395 -
Fli3g00837 314 Gene3D Mitochondrial carrier domain 109 304 IPR023395 -
Fli3g00837 314 FunFam NAD+ transporter 110 305 - -
Fli3g00837 314 FunFam Nicotinamide adenine dinucleotide transporter 1, chloroplastic 4 109 - -
Fli3g00837 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 11 103 IPR018108 -
Fli3g00837 314 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 13 305 IPR044712 GO:0006862(InterPro)|GO:0022857(PANTHER)|GO:0035352(PANTHER)|GO:0051724(PANTHER)|GO:0055085(PANTHER)|GO:0055085(InterPro)
Fli3g00837 314 Pfam Mitochondrial carrier protein 12 106 IPR018108 -
Fli3g00837 314 Pfam Mitochondrial carrier protein 112 202 IPR018108 -
Fli3g00837 314 Pfam Mitochondrial carrier protein 218 302 IPR018108 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Fli3g00837 K15115 solute carrier family 25 (mitochondrial folate transporter), member 32
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
2360332 Fli Fli15g01546 Fli-Chr15:56278102 Fli3g00837 Fli-Chr3:22798827
2360441 Fli Fli15g01682 Fli-Chr15:60085948 Fli3g00837 Fli-Chr3:22798827
2370450 Fli Fli3g00837 Fli-Chr3:22798827 Fli6g01339 Fli-Chr6:73160890
2384371 Fli Fli13g00212 Fli-Chr13:4890663 Fli3g00837 Fli-Chr3:22798827
2414904 Fli Fli15g01552 Fli-Chr15:56413699 Fli3g00837 Fli-Chr3:22798827
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Fli1g01170 . 7 143 Chloroplast and Mitochondria gene family AT1G07020 44.928 1.00e-24 91.7
Fli1g01379 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 4.73e-34 109.0
Fli1g01835 . 51 127 Chloroplast and Mitochondria gene family AT2G28800 59.259 2.88e-21 85.9
Fli1g02280 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 66.667 4.35e-101 293.0
Fli1g03008 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.567 3.21e-170 469.0
Fli2g00045 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.049 1.49e-171 479.0
Fli2g00295 ACH 1 361 Chloroplast and Mitochondria gene family AT5G14040 69.972 1.33e-179 501.0
Fli2g00753 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.606 6.56e-61 191.0
Fli2g00848 WGDA 52 91 Chloroplast and Mitochondria gene family AT4G10340 82.5 5.93e-19 76.3
Fli2g00849 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.392 1.64e-154 431.0
Fli2g01234 WGDA 7 320 Chloroplast and Mitochondria gene family AT5G15640 71.975 1.20e-174 484.0
Fli2g01235 WGDA 12 320 Chloroplast and Mitochondria gene family AT5G15640 76.375 9.40e-180 498.0
Fli2g01708 . 1 297 Chloroplast and Mitochondria gene family AT2G17270 68.687 2.10e-160 447.0
Fli2g01926 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.075 0.0 564.0
Fli2g02715 . 51 127 Chloroplast and Mitochondria gene family AT2G28800 60.494 5.92e-22 87.8
Fli3g00236 . 51 405 Chloroplast and Mitochondria gene family AT2G28800 81.894 0.0 594.0
Fli3g00837 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.623 3.84e-166 462.0
Fli3g00858 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.398 3.68e-31 119.0
Fli4g01323 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.302 1.07e-178 490.0
Fli5g00276 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 59.821 7.82e-91 265.0
Fli5g00277 . 19 224 Chloroplast and Mitochondria gene family AT1G14730 44.175 8.86e-60 186.0
Fli5g00653 . 76 407 Chloroplast and Mitochondria gene family AT2G28800 62.429 6.14e-151 439.0
Fli5g02515 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.577 1.45e-161 449.0
Fli6g00022 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 78.521 6.96e-175 485.0
Fli6g01339 WGDA 29 271 Chloroplast and Mitochondria gene family AT2G47490 35.156 3.75e-35 127.0
Fli6g01696 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.839 0.0 506.0
Fli6g02429 . 1 209 Chloroplast and Mitochondria gene family AT4G25570 69.856 8.10e-108 308.0
Fli7g00139 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 73.626 0.0 546.0
Fli8g00010 . 148 287 Chloroplast and Mitochondria gene family AT5G01530 39.726 1.04e-19 80.5
Fli8g00652 . 1 105 Chloroplast and Mitochondria gene family AT5G14040 43.81 3.40e-18 75.9
Fli9g00386 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 1.65e-171 472.0
Fli9g01159 . 250 288 Chloroplast and Mitochondria gene family AT5G01530 74.359 1.17e-15 65.5
Fli9g01220 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.91e-31 102.0
Fli9g01240 . 1 325 Chloroplast and Mitochondria gene family AT2G30160 70.732 1.55e-163 457.0
Fli10g00404 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.304 5.49e-171 478.0
Fli10g01119 . 2 258 Chloroplast and Mitochondria gene family AT1G15820 81.712 1.15e-150 419.0
Fli10g01419 . 139 266 Chloroplast and Mitochondria gene family AT2G34430 89.062 2.71e-76 226.0
Fli10g01420 . 1 108 Chloroplast and Mitochondria gene family AT1G29930 72.222 2.45e-48 153.0
Fli10g01421 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 8.03e-169 465.0
Fli11g01872 WGDA 47 75 Chloroplast and Mitochondria gene family AT3G54890 68.966 3.14e-08 47.0
Fli11g01876 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 4.15e-76 229.0
Fli11g02113 . 33 354 Chloroplast and Mitochondria gene family AT5G54290 72.671 4.38e-146 415.0
Fli12g01289 . 84 345 Chloroplast and Mitochondria gene family AT2G28800 20.567 4.90e-06 47.0
Fli12g01696 WGDA 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.541 4.53e-150 418.0
Fli12g02179 . 7 236 Chloroplast and Mitochondria gene family AT1G26100 61.983 3.18e-89 262.0
Fli13g00212 . 33 290 Chloroplast and Mitochondria gene family AT2G47490 28.621 3.22e-27 107.0
Fli13g00604 ACH 5 373 Chloroplast and Mitochondria gene family AT5G14040 76.423 0.0 577.0
Fli13g00634 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.839 0.0 507.0
Fli13g00996 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 38.246 5.04e-50 166.0
Fli14g00479 WGDA 4 295 Chloroplast and Mitochondria gene family AT4G21490 65.306 6.28e-133 387.0
Fli14g00605 ACH,WGDA 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 8.02e-151 419.0
Fli14g01622 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.914 3.21e-122 347.0
Fli14g01623 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.914 3.21e-122 347.0
Fli15g00487 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 61.413 6.20e-70 209.0
Fli15g00843 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.609 1.59e-149 416.0
Fli15g01158 ACH,WGDA 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.583 8.24e-146 405.0
Fli15g01160 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.583 8.24e-146 405.0
Fli15g01217 . 37 318 Chloroplast and Mitochondria gene family AT1G07030 32.042 1.30e-32 121.0
Fli15g01546 . 12 210 Chloroplast and Mitochondria gene family AT1G25380 66.667 1.02e-79 241.0
Fli15g01552 . 33 327 Chloroplast and Mitochondria gene family AT1G25380 65.0 1.50e-139 398.0
Fli16g00352 . 5 300 Chloroplast and Mitochondria gene family AT4G25700 65.798 3.05e-141 399.0
Fli16g00646 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.319 0.0 517.0
Fli16g01104 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 81.915 6.86e-151 422.0
Fli16g01608 . 35 307 Chloroplast and Mitochondria gene family AT5G40810 89.781 3.62e-172 478.0
Fli16g01649 . 35 307 Chloroplast and Mitochondria gene family AT5G40810 89.781 3.62e-172 478.0
Fli17g00112 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 33.214 1.16e-34 127.0
Fli17g00262 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 5.23e-122 347.0
Fli17g00477 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 7.24e-76 229.0
Fli17g00481 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 7.24e-76 229.0
Fli18g00610 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 8.65e-180 493.0
Fli18g00649 . 8 147 Chloroplast and Mitochondria gene family AT1G07020 36.667 2.16e-14 65.1
Fli10001013.1g00002 . 1 99 Chloroplast and Mitochondria gene family AT1G72820 69.697 7.89e-46 149.0
Fli10001013.1g00003 . 256 343 Chloroplast and Mitochondria gene family AT1G72820 73.864 1.69e-39 132.0
Fli10000125.1g00001 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.194 2.52e-168 464.0
Fli10000125.1g00002 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 3.43e-171 471.0
Fli10001030.1g00002 . 41 270 Chloroplast and Mitochondria gene family AT4G03320 37.449 3.43e-45 152.0
Fli10000030.1g00007 . 1 228 Chloroplast and Mitochondria gene family AT5G14040 63.596 3.29e-98 288.0
Fli10001298.1g00004 . 224 265 Chloroplast and Mitochondria gene family AT2G05070 95.238 3.09e-24 88.2