AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Fra11g00896 ATGGCTTTCACCATTGCCTCCACCTCCCATTCATCCCTTCCAACAAGGGGAGAATTCATCACAAAACTACCTTGTGCAGAAAGGAGTTGTACTCCAAGGTACATGTTCAGAAGCACCCATGGTGTACAGAAGCTCAAAGCAGCTAAAGAAGGTGTATCAAGTGTGTGTGAACCACTTCCTGCAGATAGACCAGTATGGTTCCCAGGAACCTCACCTCCTGAGTGGCTAGATGGAAGCCTCCCTGGAGATTTTGGCTTTGACCCACTTGGATTAGGGTCTGATCCTGAATTACTCAAGTGGTTTGCACAAGCTGAGTTGATGCACAGCAGATGGGCAATGCTTGCAGTTGCTGGTATTTTGATCCCAGAATGGCTAGAAAGTATGGGCTTTATCGACGATTTCTCGTGGTTCGAAGCGGGCTCTAGAGAGTACTTTGCGGATCCGACGACTTTATTCGTGGTGCAAATGGCGTTGATGGGTTGGGTGGAGGGTCGAAGATGGGCTGACATAATCAACCCTGGGTGCGTTGACATCGAGCCTAATTTTCCTAATAAGAAGAAACCAAAGCCCGATGTTGGGTACCCAGGGGGATTGTGGTTTGACCCGTTTATGTGGGGAAGAGGGTCCCCAGAGCCAGTGATGGTTCTGAGGACCAAAGAGATAAAGAATGGGCGGCTAGCCATGTTGGCTTTTGCGGGTTTTGTGTTCCAAGCCATTTACACCGGACAAGGACCCCTTGAGAACCTATCGGCTCACCTTGCGGACCCTGGCCATGTCAACATTTTCTCGGCCTTCAGCACCCAAATTCAATGA 813 49.57 MAFTIASTSHSSLPTRGEFITKLPCAERSCTPRYMFRSTHGVQKLKAAKEGVSSVCEPLPADRPVWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWLESMGFIDDFSWFEAGSREYFADPTTLFVVQMALMGWVEGRRWADIINPGCVDIEPNFPNKKKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFAGFVFQAIYTGQGPLENLSAHLADPGHVNIFSAFSTQIQ 270
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Fra11g00896 270 FunFam Chlorophyll a-b binding protein, chloroplastic 73 258 - -
Fra11g00896 270 Gene3D Chlorophyll a-b binding protein domain 73 258 - -
Fra11g00896 270 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 43 262 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Fra11g00896 270 Pfam Chlorophyll A-B binding protein 72 239 IPR022796 -
Fra11g00896 270 SUPERFAMILY Chlorophyll a-b binding protein 62 265 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Fra11g00896 K08908 light-harvesting complex I chlorophyll a/b binding protein 2
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Fra Fra-Chr11:8860010 Fra3g00014 Fra-Chr3:155926 dispersed
Fra Fra-Chr11:8860010 Fra9g00483 Fra-Chr9:4065007 transposed
Fra Fra-Chr11:8860010 Fra10g01340 Fra-Chr10:54562326 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Fra1g00835 ACH 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.577 8.78e-162 449.0
Fra1g01453 . 76 407 Chloroplast and Mitochondria gene family AT2G28800 63.277 2.73e-154 447.0
Fra1g01764 ACH 21 224 Chloroplast and Mitochondria gene family AT1G14730 44.118 5.84e-59 184.0
Fra1g01765 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 59.821 5.28e-91 265.0
Fra2g00870 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 1.37e-178 490.0
Fra3g00014 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 6.93e-76 229.0
Fra3g00157 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 2.66e-122 347.0
Fra3g00282 . 9 318 Chloroplast and Mitochondria gene family AT1G07030 31.056 5.49e-35 127.0
Fra3g00378 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 6.93e-76 229.0
Fra3g01258 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.967 1.77e-34 132.0
Fra3g01489 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 30.293 3.02e-35 134.0
Fra4g01036 WGDA 9 224 Chloroplast and Mitochondria gene family AT5G38630 40.278 9.48e-53 168.0
Fra5g00183 . 33 301 Chloroplast and Mitochondria gene family AT2G47490 28.904 5.73e-28 109.0
Fra5g00545 ACH,WGDA 5 373 Chloroplast and Mitochondria gene family AT5G14040 76.152 0.0 577.0
Fra5g00563 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.516 0.0 506.0
Fra5g00808 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.544 3.55e-48 162.0
Fra5g01009 . 33 303 Chloroplast and Mitochondria gene family AT1G25380 29.568 1.66e-13 68.6
Fra6g00607 . 1 133 Chloroplast and Mitochondria gene family AT1G29930 81.203 6.31e-72 214.0
Fra6g00608 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 2.04e-166 459.0
Fra6g00609 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 1.66e-168 464.0
Fra6g00905 . 2 258 Chloroplast and Mitochondria gene family AT1G15820 82.101 2.07e-151 421.0
Fra6g01450 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.014 6.47e-171 477.0
Fra7g01082 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 4.76e-171 471.0
Fra7g01083 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 6.06e-170 468.0
Fra7g01741 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 75.538 0.0 564.0
Fra7g01896 . 1 297 Chloroplast and Mitochondria gene family AT2G17270 69.36 2.00e-162 452.0
Fra7g02313 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 75.478 3.74e-180 499.0
Fra7g02314 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 71.656 1.26e-174 484.0
Fra7g02678 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.392 1.07e-154 431.0
Fra7g02754 . 37 250 Chloroplast and Mitochondria gene family AT3G61470 47.005 1.42e-60 190.0
Fra7g03234 ACH 1 361 Chloroplast and Mitochondria gene family AT5G14040 70.523 0.0 507.0
Fra7g03491 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.622 1.02e-173 484.0
Fra8g01048 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 7.02e-180 493.0
Fra9g00030 . 11 236 Chloroplast and Mitochondria gene family AT1G26100 61.603 1.04e-87 258.0
Fra9g00483 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.991 1.42e-150 419.0
Fra9g00787 . 84 345 Chloroplast and Mitochondria gene family AT2G28800 20.714 8.94e-06 46.2
Fra9g01171 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 66.667 3.57e-110 315.0
Fra10g00333 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.914 3.21e-122 347.0
Fra10g01340 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 6.44e-151 420.0
Fra11g00347 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 2.23e-172 474.0
Fra11g00348 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 4.56e-172 474.0
Fra11g00896 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 67.15 6.58e-102 296.0
Fra11g01344 . 65 548 Chloroplast and Mitochondria gene family AT2G18710 84.711 0.0 835.0
Fra11g01671 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 4.73e-34 109.0
Fra11g01685 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 63.006 2.06e-146 415.0
Fra11g01827 . 7 146 Chloroplast and Mitochondria gene family AT1G07020 44.444 1.72e-24 90.9
Fra11g02547 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.672 4.15e-170 469.0
Fra12g00133 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.544 4.78e-114 324.0
Fra12g00196 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 65.272 2.33e-111 317.0
Fra12g00908 ACH,WGDA 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.613 0.0 576.0
Fra12g00947 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.516 0.0 506.0
Fra12g01279 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.491 3.96e-47 159.0
Fra12g01460 . 33 294 Chloroplast and Mitochondria gene family AT1G25380 27.402 2.27e-12 65.1
Fra12g02324 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 68.662 2.63e-147 414.0
Fra13g00485 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 1.08e-171 473.0
Fra13g00559 ACH,WGDA 4 211 Chloroplast and Mitochondria gene family AT4G25570 39.904 1.98e-56 177.0
Fra13g01560 . 1 325 Chloroplast and Mitochondria gene family AT2G30160 70.732 1.09e-163 457.0
Fra13g01573 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.91e-31 102.0
Fra13g01624 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 83.15 2.67e-160 446.0
Fra13g01627 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 83.15 2.67e-160 446.0
Fra14g00089 . 41 270 Chloroplast and Mitochondria gene family AT4G03320 36.626 1.85e-43 147.0
Fra14g00109 . 41 270 Chloroplast and Mitochondria gene family AT4G03320 36.626 1.85e-43 147.0
Fra14g00192 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.923 2.23e-150 418.0
Fra14g00533 . 5 187 Chloroplast and Mitochondria gene family AT1G17530 60.963 6.84e-70 209.0
Fra14g00622 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.236 1.94e-163 459.0
Fra14g01227 . 33 327 Chloroplast and Mitochondria gene family AT1G25380 65.0 3.55e-140 400.0
Fra14g01540 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.583 8.24e-146 405.0
Fra15g00157 . 35 307 Chloroplast and Mitochondria gene family AT5G40810 89.781 3.70e-172 478.0
Fra15g00515 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 82.979 2.51e-153 428.0
Fra15g00845 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.971 0.0 518.0
Fra15g01220 . 1 300 Chloroplast and Mitochondria gene family AT4G25700 64.0 3.60e-140 397.0
Fra16g00589 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 1.26e-75 228.0
Fra16g00741 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 70.3 0.0 543.0
Fra16g00812 . 25 354 Chloroplast and Mitochondria gene family AT5G54290 71.818 4.66e-145 412.0
Fra17g01144 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 74.176 0.0 551.0
Fra18g00023 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 5.78e-171 471.0
Fra18g00024 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 5.78e-171 471.0
Fra18g01182 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.037 4.30e-168 469.0
Fra18g01258 . 51 405 Chloroplast and Mitochondria gene family AT2G28800 81.616 0.0 591.0
Fra18g01730 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.087 1.18e-30 118.0
Fra18g01748 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.623 1.56e-166 463.0