AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Fra18g01748 ATGGCCGCTGATGCCTACGCCCCCACTTCGTTCCCGATTCTCTGTAATGCTGCTGCTGGTGCTTCCGCTGGGGTTATTGCGGCTACATTTGTTTGTCCTTTAGATGTTATCAAGACTAGGTTTCAGGTTCATGGTCTTCCGCAGCTTAATGGTGGAACCGTGAGAGGTAGTCTTATAGTAGGTAGCTTAGAACAGATTTTTCGGAAGGAAGGGATGCGCGGGTTGTACCGTGGACTTTCGCCCACTATTCTTGCCTTGCTTCCAAACTGGGCGGTTTATTTTACTATCTACGAGCAGCTCAAAGGTCTGCTTGGCTCTGATGGAATTCATGGCCTGTCTTTTGGTGCCAATATGGTAGCTGCTTCAGGGGCTGGAGCTGCAACAACCATTGTGACAAATCCTTTGTGGGTTGTGAAGACAAGGCTACAAACTCAAGGAATGAGAACAGGCCTGATACCATATAGGGGTACGCTATCAGCTTTGAGAAAAATTGCTCATGAAGAGGGTATTCGTGGCTTATACAGTGGTCTAGTACCTGCACTGGTGGGCATTAGTCATGTTGCTATCCAATTTCCAGCTTATGAGAAGATCAAAATCTATTTGGCTAGTAGAGAGGGTACCACAGCTGATAAACTTGGTGCTCGTGATGTCGCTGTTGCTTCTTCTGTTTCAAAAATATTTGCATCCACTTTAACATATCCACATGAGGTTGTTAGGTCAAGGCTGCAAGAACAAGGGCACCATACTGAAAAGAGGTACTCGGGAATGGTTGATTGCATAAAGAAAGTATTTGCAAAAGAAGGGCTTCCTGGGTTCTACCGTGGTTGTGCTACTAACCTGTTCAGGACAACCCCTGCTGCTGTTATAACATTTACCAGCTTTGAAATGATTCACCGGTTTCTTGTCACTTTATTCCCTTCTGACCCTCAACCTCACACATTATGA 945 45.61 MAADAYAPTSFPILCNAAAGASAGVIAATFVCPLDVIKTRFQVHGLPQLNGGTVRGSLIVGSLEQIFRKEGMRGLYRGLSPTILALLPNWAVYFTIYEQLKGLLGSDGIHGLSFGANMVAASGAGAATTIVTNPLWVVKTRLQTQGMRTGLIPYRGTLSALRKIAHEEGIRGLYSGLVPALVGISHVAIQFPAYEKIKIYLASREGTTADKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHTEKRYSGMVDCIKKVFAKEGLPGFYRGCATNLFRTTPAAVITFTSFEMIHRFLVTLFPSDPQPHTL 314
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Fra18g01748 314 Gene3D Mitochondrial carrier domain 109 304 IPR023395 -
Fra18g01748 314 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 13 305 IPR044712 GO:0006862(InterPro)|GO:0022857(PANTHER)|GO:0035352(PANTHER)|GO:0051724(PANTHER)|GO:0055085(InterPro)|GO:0055085(PANTHER)
Fra18g01748 314 PRINTS Mitochondrial carrier protein signature 16 29 IPR002067 GO:0055085(InterPro)
Fra18g01748 314 PRINTS Mitochondrial carrier protein signature 127 145 IPR002067 GO:0055085(InterPro)
Fra18g01748 314 PRINTS Mitochondrial carrier protein signature 29 43 IPR002067 GO:0055085(InterPro)
Fra18g01748 314 PRINTS Mitochondrial carrier protein signature 78 98 IPR002067 GO:0055085(InterPro)
Fra18g01748 314 PRINTS Mitochondrial carrier protein signature 221 243 IPR002067 GO:0055085(InterPro)
Fra18g01748 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 11 103 IPR018108 -
Fra18g01748 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 112 200 IPR018108 -
Fra18g01748 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 212 300 IPR018108 -
Fra18g01748 314 Gene3D Mitochondrial carrier domain 3 108 IPR023395 -
Fra18g01748 314 FunFam Nicotinamide adenine dinucleotide transporter 1, chloroplastic 4 109 - -
Fra18g01748 314 Pfam Mitochondrial carrier protein 112 202 IPR018108 -
Fra18g01748 314 Pfam Mitochondrial carrier protein 218 302 IPR018108 -
Fra18g01748 314 Pfam Mitochondrial carrier protein 12 106 IPR018108 -
Fra18g01748 314 FunFam NAD+ transporter 110 305 - -
Fra18g01748 314 SUPERFAMILY Mitochondrial carrier 11 296 IPR023395 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Fra18g01748 K15115 solute carrier family 25 (mitochondrial folate transporter), member 32
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
2438276 Fra Fra14g01227 Fra-Chr14:43672030 Fra18g01748 Fra-Chr18:65838359
2443958 Fra Fra18g01748 Fra-Chr18:65838359 Fra5g00183 Fra-Chr5:2096191
2461972 Fra Fra18g01748 Fra-Chr18:65838359 Fra5g00808 Fra-Chr5:10524420
2465845 Fra Fra18g01748 Fra-Chr18:65838359 Fra12g01279 Fra-Chr12:15113025
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Fra1g00835 ACH 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.577 8.78e-162 449.0
Fra1g01453 . 76 407 Chloroplast and Mitochondria gene family AT2G28800 63.277 2.73e-154 447.0
Fra1g01764 ACH 21 224 Chloroplast and Mitochondria gene family AT1G14730 44.118 5.84e-59 184.0
Fra1g01765 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 59.821 5.28e-91 265.0
Fra2g00870 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 1.37e-178 490.0
Fra3g00014 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 6.93e-76 229.0
Fra3g00157 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 2.66e-122 347.0
Fra3g00282 . 9 318 Chloroplast and Mitochondria gene family AT1G07030 31.056 5.49e-35 127.0
Fra3g00378 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 6.93e-76 229.0
Fra3g01258 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.967 1.77e-34 132.0
Fra3g01489 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 30.293 3.02e-35 134.0
Fra4g01036 WGDA 9 224 Chloroplast and Mitochondria gene family AT5G38630 40.278 9.48e-53 168.0
Fra5g00183 . 33 301 Chloroplast and Mitochondria gene family AT2G47490 28.904 5.73e-28 109.0
Fra5g00545 ACH,WGDA 5 373 Chloroplast and Mitochondria gene family AT5G14040 76.152 0.0 577.0
Fra5g00563 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.516 0.0 506.0
Fra5g00808 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.544 3.55e-48 162.0
Fra5g01009 . 33 303 Chloroplast and Mitochondria gene family AT1G25380 29.568 1.66e-13 68.6
Fra6g00607 . 1 133 Chloroplast and Mitochondria gene family AT1G29930 81.203 6.31e-72 214.0
Fra6g00608 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 2.04e-166 459.0
Fra6g00609 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 1.66e-168 464.0
Fra6g00905 . 2 258 Chloroplast and Mitochondria gene family AT1G15820 82.101 2.07e-151 421.0
Fra6g01450 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.014 6.47e-171 477.0
Fra7g01082 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 4.76e-171 471.0
Fra7g01083 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 6.06e-170 468.0
Fra7g01741 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 75.538 0.0 564.0
Fra7g01896 . 1 297 Chloroplast and Mitochondria gene family AT2G17270 69.36 2.00e-162 452.0
Fra7g02313 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 75.478 3.74e-180 499.0
Fra7g02314 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 71.656 1.26e-174 484.0
Fra7g02678 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.392 1.07e-154 431.0
Fra7g02754 . 37 250 Chloroplast and Mitochondria gene family AT3G61470 47.005 1.42e-60 190.0
Fra7g03234 ACH 1 361 Chloroplast and Mitochondria gene family AT5G14040 70.523 0.0 507.0
Fra7g03491 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.622 1.02e-173 484.0
Fra8g01048 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 7.02e-180 493.0
Fra9g00030 . 11 236 Chloroplast and Mitochondria gene family AT1G26100 61.603 1.04e-87 258.0
Fra9g00483 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.991 1.42e-150 419.0
Fra9g00787 . 84 345 Chloroplast and Mitochondria gene family AT2G28800 20.714 8.94e-06 46.2
Fra9g01171 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 66.667 3.57e-110 315.0
Fra10g00333 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.914 3.21e-122 347.0
Fra10g01340 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 6.44e-151 420.0
Fra11g00347 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 2.23e-172 474.0
Fra11g00348 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 4.56e-172 474.0
Fra11g00896 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 67.15 6.58e-102 296.0
Fra11g01344 . 65 548 Chloroplast and Mitochondria gene family AT2G18710 84.711 0.0 835.0
Fra11g01671 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 4.73e-34 109.0
Fra11g01685 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 63.006 2.06e-146 415.0
Fra11g01827 . 7 146 Chloroplast and Mitochondria gene family AT1G07020 44.444 1.72e-24 90.9
Fra11g02547 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.672 4.15e-170 469.0
Fra12g00133 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.544 4.78e-114 324.0
Fra12g00196 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 65.272 2.33e-111 317.0
Fra12g00908 ACH,WGDA 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.613 0.0 576.0
Fra12g00947 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.516 0.0 506.0
Fra12g01279 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.491 3.96e-47 159.0
Fra12g01460 . 33 294 Chloroplast and Mitochondria gene family AT1G25380 27.402 2.27e-12 65.1
Fra12g02324 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 68.662 2.63e-147 414.0
Fra13g00485 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 1.08e-171 473.0
Fra13g00559 ACH,WGDA 4 211 Chloroplast and Mitochondria gene family AT4G25570 39.904 1.98e-56 177.0
Fra13g01560 . 1 325 Chloroplast and Mitochondria gene family AT2G30160 70.732 1.09e-163 457.0
Fra13g01573 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.91e-31 102.0
Fra13g01624 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 83.15 2.67e-160 446.0
Fra13g01627 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 83.15 2.67e-160 446.0
Fra14g00089 . 41 270 Chloroplast and Mitochondria gene family AT4G03320 36.626 1.85e-43 147.0
Fra14g00109 . 41 270 Chloroplast and Mitochondria gene family AT4G03320 36.626 1.85e-43 147.0
Fra14g00192 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.923 2.23e-150 418.0
Fra14g00533 . 5 187 Chloroplast and Mitochondria gene family AT1G17530 60.963 6.84e-70 209.0
Fra14g00622 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.236 1.94e-163 459.0
Fra14g01227 . 33 327 Chloroplast and Mitochondria gene family AT1G25380 65.0 3.55e-140 400.0
Fra14g01540 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.583 8.24e-146 405.0
Fra15g00157 . 35 307 Chloroplast and Mitochondria gene family AT5G40810 89.781 3.70e-172 478.0
Fra15g00515 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 82.979 2.51e-153 428.0
Fra15g00845 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.971 0.0 518.0
Fra15g01220 . 1 300 Chloroplast and Mitochondria gene family AT4G25700 64.0 3.60e-140 397.0
Fra16g00589 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 1.26e-75 228.0
Fra16g00741 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 70.3 0.0 543.0
Fra16g00812 . 25 354 Chloroplast and Mitochondria gene family AT5G54290 71.818 4.66e-145 412.0
Fra17g01144 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 74.176 0.0 551.0
Fra18g00023 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 5.78e-171 471.0
Fra18g00024 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 5.78e-171 471.0
Fra18g01182 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.037 4.30e-168 469.0
Fra18g01258 . 51 405 Chloroplast and Mitochondria gene family AT2G28800 81.616 0.0 591.0
Fra18g01730 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.087 1.18e-30 118.0
Fra18g01748 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.623 1.56e-166 463.0