AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Fro12g00900 ATGGCTTTCACCATTGCTTCCACCTCCCATTCATCCCTTCCAACAAGGGGAGAATTCATCACAAGACAACCTTCTGCAGAAAGAAGTTGTACTCCAAGGTACATGTTCAGAAGCACCCATGGAGTACAGAAGCTCAAAGCAGCTAAAGAAGGTGTATCAAGTGTGTGTGAACCACTTCCTGCAGATAGACCAGTATGGTTCCCAGGAACCTCACCTCCTGAATGGCTCGATGGAAGCCTCCCTGGAGATTTTGGCTTCGACCCACTTGGATTAGGGTCTGATCCTGAATTACTCAAGTGGTTTGCACAAGCTGAGTTGATGCACAGCAGATGGGCAATGCTTGCAGTTGCTGGTATTCTGATACCAGAATGGCTAGAAAGTATGGGCTTTATCAACGATTTCTCGTGGTTCAAAGCGGGCTCTAGAGAGTACTTTGCGGATCCGACCACTTTATTCGTGGTGCAAATGGCGTTGATGGGTTGGGTGGAGGGTCGAAGATGGGCTGACATGATCAACCCTGGGTGCGTTGACATCGAGCCTAACCTTCCCAATAAGAAGAAACCAAAACCCTGGGTTGGGTGA 582 48.63 MAFTIASTSHSSLPTRGEFITRQPSAERSCTPRYMFRSTHGVQKLKAAKEGVSSVCEPLPADRPVWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWLESMGFINDFSWFKAGSREYFADPTTLFVVQMALMGWVEGRRWADMINPGCVDIEPNLPNKKKPKPWVG 193
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Fro12g00900 193 Gene3D Chlorophyll a-b binding protein domain 73 191 - -
Fro12g00900 193 Pfam Chlorophyll A-B binding protein 72 177 IPR022796 -
Fro12g00900 193 SUPERFAMILY Chlorophyll a-b binding protein 62 177 - -
Fro12g00900 193 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 37 176 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Fro12g00900 - -
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Fro Fro-Chr12:8664273 Fro6g00289 Fro-Chr6:3451905 dispersed
Fro Fro-Chr12:8664273 Fro8g00452 Fro-Chr8:3599619 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Fro1g00295 . 1 300 Chloroplast and Mitochondria gene family AT4G25700 65.723 9.96e-143 403.0
Fro1g00610 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.993 0.0 513.0
Fro1g00906 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.333 1.25e-154 431.0
Fro1g01257 . 31 307 Chloroplast and Mitochondria gene family AT5G40810 88.489 7.65e-173 480.0
Fro2g00419 WGDA 4 580 Chloroplast and Mitochondria gene family AT4G21490 66.897 0.0 809.0
Fro2g00540 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.892 5.83e-151 420.0
Fro2g01374 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.914 3.21e-122 347.0
Fro3g00285 . 12 327 Chloroplast and Mitochondria gene family AT1G25380 64.174 4.72e-140 399.0
Fro3g00555 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.167 8.33e-146 405.0
Fro3g00786 . 41 271 Chloroplast and Mitochondria gene family AT4G03320 36.885 7.96e-44 148.0
Fro3g00954 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.923 1.34e-151 421.0
Fro3g01287 . 4 157 Chloroplast and Mitochondria gene family AT1G72750 60.39 2.58e-62 189.0
Fro3g01309 . 4 188 Chloroplast and Mitochondria gene family AT1G72750 63.243 1.54e-70 210.0
Fro3g01412 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.406 1.74e-167 469.0
Fro3g01442 . 1 85 Chloroplast and Mitochondria gene family AT1G72820 63.529 3.92e-35 120.0
Fro3g01443 . 99 343 Chloroplast and Mitochondria gene family AT1G72820 67.206 8.93e-110 318.0
Fro4g00325 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.725 1.33e-169 474.0
Fro4g00843 . 2 258 Chloroplast and Mitochondria gene family AT1G15820 80.769 1.19e-149 416.0
Fro4g01084 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 1.30e-168 465.0
Fro5g00397 WGDA 33 294 Chloroplast and Mitochondria gene family AT1G25380 29.577 8.67e-12 63.5
Fro5g00527 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.544 9.17e-49 163.0
Fro5g00765 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.516 0.0 506.0
Fro5g00783 ACH,WGDA 5 373 Chloroplast and Mitochondria gene family AT5G14040 76.694 0.0 580.0
Fro5g01162 . 33 294 Chloroplast and Mitochondria gene family AT2G47490 28.231 2.21e-27 107.0
Fro6g00289 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 66.667 3.07e-101 294.0
Fro6g00533 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.967 4.78e-33 127.0
Fro6g00912 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 4.34e-76 229.0
Fro6g01058 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 6.88e-122 347.0
Fro6g01187 . 41 316 Chloroplast and Mitochondria gene family AT1G07030 33.453 1.34e-34 126.0
Fro7g00803 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.434 6.02e-180 493.0
Fro8g00019 ACH 11 236 Chloroplast and Mitochondria gene family AT1G26100 62.447 1.46e-88 260.0
Fro8g00452 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.541 7.42e-150 417.0
Fro8g00775 . 84 345 Chloroplast and Mitochondria gene family AT2G28800 20.495 5.78e-07 50.1
Fro8g01187 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 65.789 1.68e-108 310.0
Fro9g01228 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.302 2.92e-179 491.0
Fro10g00992 WGDA 4 208 Chloroplast and Mitochondria gene family AT4G25570 43.902 1.96e-54 172.0
Fro11g00042 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 68.195 5.68e-174 485.0
Fro11g00259 ACH 1 361 Chloroplast and Mitochondria gene family AT5G14040 69.972 1.07e-180 504.0
Fro11g00634 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.154 2.85e-60 190.0
Fro11g00701 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.392 1.07e-154 431.0
Fro11g01069 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 72.293 1.90e-175 487.0
Fro11g01478 . 1 303 Chloroplast and Mitochondria gene family AT2G17270 67.987 1.39e-162 453.0
Fro11g01639 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.344 0.0 566.0
Fro11g02271 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 9.30e-170 468.0
Fro11g02272 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 2.26e-169 467.0
Fro12g00349 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 2.23e-172 474.0
Fro12g00350 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 3.07e-172 474.0
Fro12g00899 . 197 257 Chloroplast and Mitochondria gene family AT3G61470 67.213 1.68e-23 87.8
Fro12g00900 . 51 175 Chloroplast and Mitochondria gene family AT3G61470 66.4 4.80e-60 186.0
Fro12g01251 . 65 548 Chloroplast and Mitochondria gene family AT2G18710 84.504 0.0 827.0
Fro12g01530 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 66.667 4.73e-34 109.0
Fro12g01541 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 62.717 3.96e-147 417.0
Fro12g01722 . 7 143 Chloroplast and Mitochondria gene family AT1G07020 42.177 2.07e-23 88.2
Fro12g02408 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 89.453 1.65e-170 470.0
Fro12g02503 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 89.453 1.65e-170 470.0
Fro13g00342 WGDA 13 224 Chloroplast and Mitochondria gene family AT5G38630 41.981 1.08e-56 178.0
Fro13g00381 . 4 211 Chloroplast and Mitochondria gene family AT4G25570 39.904 5.38e-57 179.0
Fro13g00455 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 4.01e-171 471.0
Fro13g01158 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 82.784 3.22e-160 446.0
Fro13g01207 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.91e-31 102.0
Fro13g01222 WGDA 1 325 Chloroplast and Mitochondria gene family AT2G30160 71.037 6.31e-164 458.0
Fro14g00860 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.73e-170 469.0
Fro14g01249 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.087 6.69e-31 118.0
Fro14g01266 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.623 4.88e-166 462.0
Fro14g01612 WGDA 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.646 1.27e-168 470.0
Fro14g01690 . 51 405 Chloroplast and Mitochondria gene family AT2G28800 81.667 0.0 592.0
Fro15g00007 . 42 327 Chloroplast and Mitochondria gene family AT1G76570 79.021 2.00e-177 491.0
Fro15g01176 WGDA 33 294 Chloroplast and Mitochondria gene family AT1G25380 28.873 3.96e-13 67.4
Fro15g01388 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.895 1.25e-48 163.0
Fro15g01542 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 68.421 1.06e-114 325.0
Fro15g01688 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.839 0.0 507.0
Fro15g01725 ACH,WGDA 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.882 0.0 575.0
Fro15g02402 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 65.69 1.43e-112 320.0
Fro16g00299 . 70 354 Chloroplast and Mitochondria gene family AT5G54290 80.0 2.34e-145 413.0
Fro16g00361 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 70.027 0.0 538.0
Fro16g00428 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 70.027 0.0 538.0
Fro16g00723 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.716 4.86e-77 232.0
Fro17g01546 ACH 72 364 Chloroplast and Mitochondria gene family AT5G14040 85.666 0.0 527.0
Fro17g01693 . 1 364 Chloroplast and Mitochondria gene family AT5G14040 75.275 0.0 551.0
Fro18g00019 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.847 7.13e-162 449.0
Fro18g01396 . 76 407 Chloroplast and Mitochondria gene family AT2G28800 62.89 9.61e-152 439.0
Fro18g01724 . 18 224 Chloroplast and Mitochondria gene family AT1G14730 43.961 1.43e-59 185.0
Fro18g01725 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 60.268 2.67e-92 268.0
Fro10000366.1g00006 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 60.268 2.67e-92 268.0
Fro10000310.1g00007 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.716 4.86e-77 232.0