AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Fso1g02074 ATGGCCGCTGATGCCTACGCCCCCACTTCGTTCCCGATTCTCTGTAATGCTGCTGCTGGTGCTTCCGCTGGGGTAATTGCGGCTACATTTGTATGTCCTTTAGATGTGATCAAGACTAGGTTTCAGGTTCATGGTCTCCCGCAGCTTAACGGTGGAACCATGAGAGGTAGTCTTATAGTAGGTAGCTTAGAACAGATTTTTCGGAAGGAAGGGGTGCGCGGGTTGTACCGTGGGCTTTCTCCTACTATTCTTGCCTTGCTTCCAAACTGGGCGGTTTATTTTACTATCTACGAGCAGCTCAAAGGTCTGCTTGGCTCTGATGGAATTCATGGCCTGTCTTTTGGTGCCAATATGGTAGCTGCTTCAGGGGCTGGAGCTGCAACAACCATTGTGACAAATCCTTTGTGGGTTGTGAAGACAAGGCTACAAACTCAAGGAATGAGAACAGGCCTGATACCATATAGGGGTACGCTATCAGCTTTGAGAAAAATTGCTCATGAAGAGGGTATTCGTGGCTTATACAGTGGTCTAGTACCTGCACTGGTGGGCATTAGTCATGTTGCAATCCAATTTCCAGCTTATGAGAAGATCAAAATCTATTTGGCTAGTAGAGAGGGTACCACAGCTGATAAACTTGGTGCTCGTGATGTCGCTGTTGCTTCTTCTGTTTCAAAAATATTTGCATCCACTTTAACATATCCACATGAGGTTGTTAGGTCAAGGCTGCAAGAACAAGGGCACCATTCTGAAAAGAGGTACTCGGGAATGGTTGATTGCATAAAGAAAGTATTTGCAAAAGAAGGGCTTCCTGGGTTCTACCGCGGTTGTGCTACTAACCTGTTCAGGACAACCCCTGCTGCTGTTATAACATTTACCAGCTTTGAAATGATTCACCGGTTTCTTGTCACTTTATTCCCATCTGATCCTCAACCTCACACATTATGA 945 45.82 MAADAYAPTSFPILCNAAAGASAGVIAATFVCPLDVIKTRFQVHGLPQLNGGTMRGSLIVGSLEQIFRKEGVRGLYRGLSPTILALLPNWAVYFTIYEQLKGLLGSDGIHGLSFGANMVAASGAGAATTIVTNPLWVVKTRLQTQGMRTGLIPYRGTLSALRKIAHEEGIRGLYSGLVPALVGISHVAIQFPAYEKIKIYLASREGTTADKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYSGMVDCIKKVFAKEGLPGFYRGCATNLFRTTPAAVITFTSFEMIHRFLVTLFPSDPQPHTL 314
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Fso1g02074 314 PRINTS Mitochondrial carrier protein signature 16 29 IPR002067 GO:0055085(InterPro)
Fso1g02074 314 PRINTS Mitochondrial carrier protein signature 127 145 IPR002067 GO:0055085(InterPro)
Fso1g02074 314 PRINTS Mitochondrial carrier protein signature 29 43 IPR002067 GO:0055085(InterPro)
Fso1g02074 314 PRINTS Mitochondrial carrier protein signature 78 98 IPR002067 GO:0055085(InterPro)
Fso1g02074 314 PRINTS Mitochondrial carrier protein signature 221 243 IPR002067 GO:0055085(InterPro)
Fso1g02074 314 Gene3D Mitochondrial carrier domain 3 108 IPR023395 -
Fso1g02074 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 112 200 IPR018108 -
Fso1g02074 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 212 300 IPR018108 -
Fso1g02074 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 11 103 IPR018108 -
Fso1g02074 314 Gene3D Mitochondrial carrier domain 109 304 IPR023395 -
Fso1g02074 314 Pfam Mitochondrial carrier protein 218 302 IPR018108 -
Fso1g02074 314 Pfam Mitochondrial carrier protein 112 202 IPR018108 -
Fso1g02074 314 Pfam Mitochondrial carrier protein 12 106 IPR018108 -
Fso1g02074 314 SUPERFAMILY Mitochondrial carrier 11 296 IPR023395 -
Fso1g02074 314 FunFam Nicotinamide adenine dinucleotide transporter 1, chloroplastic 4 109 - -
Fso1g02074 314 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 13 305 IPR044712 GO:0006862(InterPro)|GO:0022857(PANTHER)|GO:0035352(PANTHER)|GO:0051724(PANTHER)|GO:0055085(InterPro)|GO:0055085(PANTHER)
Fso1g02074 314 FunFam NAD+ transporter 110 305 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Fso1g02074 K15115 solute carrier family 25 (mitochondrial folate transporter), member 32
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
2592051 Fso Fso12g01698 Fso-Chr12:54248206 Fso1g02074 Fso-Chr1:60367762
2599354 Fso Fso16g00268 Fso-Chr16:3872225 Fso1g02074 Fso-Chr1:60367762
2606429 Fso Fso1g02074 Fso-Chr1:60367762 Fso8g01935 Fso-Chr8:49233495
2628245 Fso Fso1g02074 Fso-Chr1:60367762 Fso18g01989 Fso-Chr18:66694991
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Fso1g01033 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 64.035 2.39e-106 304.0
Fso1g01114 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 8.21e-170 468.0
Fso1g01888 . 49 81 Chloroplast and Mitochondria gene family AT4G25570 57.576 8.06e-07 43.1
Fso1g02074 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.623 6.78e-166 462.0
Fso1g02526 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.341 3.39e-169 472.0
Fso1g02609 . 51 405 Chloroplast and Mitochondria gene family AT2G28800 81.944 0.0 592.0
Fso2g00170 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 62.069 2.22e-101 295.0
Fso2g00169 . 108 273 Chloroplast and Mitochondria gene family AT1G61520 77.844 3.13e-88 257.0
Fso2g01455 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 62.536 1.06e-144 410.0
Fso2g01479 . 1 70 Chloroplast and Mitochondria gene family AT5G05370 67.143 1.18e-32 105.0
Fso2g02014 . 47 548 Chloroplast and Mitochondria gene family AT2G18710 81.496 0.0 833.0
Fso2g02459 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 66.667 3.82e-101 294.0
Fso2g03008 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 2.09e-170 469.0
Fso2g03009 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 9.61e-172 473.0
Fso3g00480 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 2.84e-76 230.0
Fso4g00924 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 3.85e-178 489.0
Fso6g00526 WGDA 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.892 3.98e-151 420.0
Fso6g01799 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.914 3.21e-122 347.0
Fso8g00346 . 1 159 Chloroplast and Mitochondria gene family AT1G72820 70.44 3.17e-73 221.0
Fso8g00347 WGDA 212 343 Chloroplast and Mitochondria gene family AT1G72820 68.182 1.23e-56 177.0
Fso8g00457 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 61.413 5.56e-70 209.0
Fso8g00949 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.375 3.87e-151 420.0
Fso8g01273 . 41 270 Chloroplast and Mitochondria gene family AT4G03320 37.037 3.57e-44 149.0
Fso8g01647 ACH,WGDA 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.583 8.24e-146 405.0
Fso8g01703 . 37 318 Chloroplast and Mitochondria gene family AT1G07030 32.042 1.22e-32 122.0
Fso8g01935 . 12 327 Chloroplast and Mitochondria gene family AT1G25380 64.174 6.00e-140 399.0
Fso9g00112 . 41 324 Chloroplast and Mitochondria gene family AT1G07030 32.867 6.91e-35 127.0
Fso9g00271 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 67.669 9.50e-122 346.0
Fso9g00471 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 4.34e-76 229.0
Fso9g01351 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 32.143 5.92e-33 127.0
Fso10g01649 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.41e-171 472.0
Fso10g01650 WGDA 1 144 Chloroplast and Mitochondria gene family AT1G29930 85.517 4.50e-85 249.0
Fso10g02395 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.075 0.0 565.0
Fso10g02563 . 1 297 Chloroplast and Mitochondria gene family AT2G17270 69.36 8.41e-162 451.0
Fso10g02581 . 1 297 Chloroplast and Mitochondria gene family AT2G17270 69.36 8.41e-162 451.0
Fso10g02989 . 12 320 Chloroplast and Mitochondria gene family AT5G15640 76.375 5.20e-180 498.0
Fso10g02990 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 72.293 8.80e-175 485.0
Fso10g03405 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.392 1.07e-154 431.0
Fso10g03406 . 2 64 Chloroplast and Mitochondria gene family AT4G10340 58.462 6.37e-07 43.1
Fso10g03479 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.606 8.24e-61 191.0
Fso10g03864 . 1 361 Chloroplast and Mitochondria gene family AT5G14040 70.083 0.0 505.0
Fso11g01094 ACH,WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 7.02e-180 493.0
Fso12g00298 ACH 2 211 Chloroplast and Mitochondria gene family AT4G25570 38.571 1.22e-54 173.0
Fso12g00402 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 1.65e-171 472.0
Fso12g01672 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 82.418 9.18e-158 439.0
Fso12g01752 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.91e-31 102.0
Fso12g01774 . 1 282 Chloroplast and Mitochondria gene family AT2G30160 68.07 3.19e-130 370.0
Fso13g00911 . 1 161 Chloroplast and Mitochondria gene family AT1G29930 82.609 1.75e-91 265.0
Fso13g00912 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.71e-167 462.0
Fso13g01431 . 2 258 Chloroplast and Mitochondria gene family AT1G15820 82.101 2.93e-151 420.0
Fso13g01476 . 54 143 Chloroplast and Mitochondria gene family AT4G25570 54.444 1.37e-25 93.6
Fso13g02031 . 1 229 Chloroplast and Mitochondria gene family AT1G72820 71.429 2.60e-112 325.0
Fso13g02032 WGDA 256 343 Chloroplast and Mitochondria gene family AT1G72820 76.136 4.51e-41 135.0
Fso14g00293 ACH 1 224 Chloroplast and Mitochondria gene family AT1G14730 59.821 7.57e-91 265.0
Fso14g00294 ACH 19 224 Chloroplast and Mitochondria gene family AT1G14730 44.66 1.40e-60 187.0
Fso14g00595 . 36 407 Chloroplast and Mitochondria gene family AT2G28800 58.333 5.21e-153 444.0
Fso14g02574 ACH 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.482 8.48e-161 447.0
Fso15g01523 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 65.789 1.32e-108 311.0
Fso15g01524 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 65.789 1.32e-108 311.0
Fso15g01997 . 84 345 Chloroplast and Mitochondria gene family AT2G28800 21.277 1.66e-07 51.6
Fso15g02345 WGDA 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 1.69e-150 419.0
Fso15g02821 . 1 236 Chloroplast and Mitochondria gene family AT1G26100 60.0 4.90e-89 261.0
Fso16g00268 . 33 294 Chloroplast and Mitochondria gene family AT2G47490 28.571 3.41e-28 110.0
Fso16g00652 ACH,WGDA 5 373 Chloroplast and Mitochondria gene family AT5G14040 76.152 0.0 575.0
Fso16g00677 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 83.388 1.74e-178 493.0
Fso16g00999 WGDA 133 309 Chloroplast and Mitochondria gene family AT1G25380 36.957 4.16e-34 123.0
Fso16g01308 WGDA 33 294 Chloroplast and Mitochondria gene family AT1G25380 29.225 2.72e-12 65.1
Fso17g00449 . 1 300 Chloroplast and Mitochondria gene family AT4G25700 64.396 5.70e-144 406.0
Fso17g01097 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.993 0.0 515.0
Fso17g01464 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.333 2.60e-154 430.0
Fso17g01833 . 35 307 Chloroplast and Mitochondria gene family AT5G40810 90.146 5.69e-173 480.0
Fso18g00021 . 42 327 Chloroplast and Mitochondria gene family AT1G76570 78.671 3.44e-176 488.0
Fso18g01752 WGDA 33 294 Chloroplast and Mitochondria gene family AT1G25380 27.402 9.16e-12 63.5
Fso18g01989 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.842 5.57e-47 158.0
Fso18g02165 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.982 2.86e-114 324.0
Fso18g02333 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.839 0.0 508.0
Fso18g02361 WGDA 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.075 0.0 568.0
Fso18g03057 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 65.272 1.79e-111 318.0
Fso10000291.1g00003 . 70 354 Chloroplast and Mitochondria gene family AT5G54290 79.649 7.30e-145 412.0
Fso10000493.1g00007 . 4 580 Chloroplast and Mitochondria gene family AT4G21490 67.241 0.0 814.0
Fso10001015.1g00003 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 8.27e-171 470.0
Fso10000815.1g00001 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.908 7.67e-175 487.0