AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Fso2g02459 ATGGCTTTCACCATTGCTTCCACCTCCCATTCATCCCTCCCAACAAGGGGAGACTTCATCACAAAACTACCTTCTGCAGAAAGGAGTTGTACTCCAAGGTACATGTTCAGAAGCACCCATGGAGTACAGAAGCTCAAAGCAGCTAAAGAAGGTGTATCAAGTGTGTGTGAACCACTTCCTGCAGATAGACCAGTATGGTTCCCAGGAACCTCACCTCCTGAATGGCTAGATGGAAGCCTCCCTGGAGATTTTGGCTTTGACCCACTTGGATTAGGGTCTGATCCTGAATTACTCAAGTGGTTTGCACAAGCTGAGTTGATGCACAGCAGATGGGCAATGCTTGCAGTTGCTGGCATTTTGATACCAGAATGGCTAGAAAGTATGGGCTTTATCGACGATTTCTCGTGGTTCGAAGCGGGCTCTAGAGAGTACTTTGCTGATCCGACCACTTTATTCGTGGTACAAATGGCGTTGATGGGTTGGGTGGAGGGTCGAAGATGGGCTGACATAATCAATCCTGGGTGTGTTGACATCGAGCCTAATCTTCCTAATAAGAAGAAACCAAAGCCAGATGTTGGGTACCCAGGGGGATTGTGGTTTGACCCGTTTATGTGGGGAAGAGGGTCCCCGGAACCAGTGATGGTTCTGAGGACCAAAGAGATAAAGAATGGGCGGCTAGCCATGCTAGCTTTTGCGGGTTTTGTGTTCCAAGCCATTTACACCGGGCAAGGACCCCTTGAGAACCTATCAGCTCACCTCGCGGACCCTGGTCACGTCAACATTTTCTCGGCCTTCAGCACCCAAATTCAATGA 813 49.2 MAFTIASTSHSSLPTRGDFITKLPSAERSCTPRYMFRSTHGVQKLKAAKEGVSSVCEPLPADRPVWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWLESMGFIDDFSWFEAGSREYFADPTTLFVVQMALMGWVEGRRWADIINPGCVDIEPNLPNKKKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFAGFVFQAIYTGQGPLENLSAHLADPGHVNIFSAFSTQIQ 270
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Fso2g02459 270 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 42 262 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Fso2g02459 270 Pfam Chlorophyll A-B binding protein 72 239 IPR022796 -
Fso2g02459 270 SUPERFAMILY Chlorophyll a-b binding protein 62 265 - -
Fso2g02459 270 Gene3D Chlorophyll a-b binding protein domain 73 258 - -
Fso2g02459 270 FunFam Chlorophyll a-b binding protein, chloroplastic 73 258 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Fso2g02459 K08908 light-harvesting complex I chlorophyll a/b binding protein 2
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Fso Fso-Chr13:52858858 Fso2g02459 Fso-Chr2:61106684 dispersed
Fso Fso-Chr15:71167287 Fso2g02459 Fso-Chr2:61106684 dispersed
Fso Fso-Chr2:61106684 Fso3g00480 Fso-Chr3:7300617 dispersed
Fso Fso-Chr2:61106684 Fso6g00526 Fso-Chr6:6022646 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Fso1g01033 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 64.035 2.39e-106 304.0
Fso1g01114 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 8.21e-170 468.0
Fso1g01888 . 49 81 Chloroplast and Mitochondria gene family AT4G25570 57.576 8.06e-07 43.1
Fso1g02074 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.623 6.78e-166 462.0
Fso1g02526 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.341 3.39e-169 472.0
Fso1g02609 . 51 405 Chloroplast and Mitochondria gene family AT2G28800 81.944 0.0 592.0
Fso2g00170 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 62.069 2.22e-101 295.0
Fso2g00169 . 108 273 Chloroplast and Mitochondria gene family AT1G61520 77.844 3.13e-88 257.0
Fso2g01455 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 62.536 1.06e-144 410.0
Fso2g01479 . 1 70 Chloroplast and Mitochondria gene family AT5G05370 67.143 1.18e-32 105.0
Fso2g02014 . 47 548 Chloroplast and Mitochondria gene family AT2G18710 81.496 0.0 833.0
Fso2g02459 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 66.667 3.82e-101 294.0
Fso2g03008 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 2.09e-170 469.0
Fso2g03009 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 9.61e-172 473.0
Fso3g00480 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 2.84e-76 230.0
Fso4g00924 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 3.85e-178 489.0
Fso6g00526 WGDA 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.892 3.98e-151 420.0
Fso6g01799 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 66.914 3.21e-122 347.0
Fso8g00346 . 1 159 Chloroplast and Mitochondria gene family AT1G72820 70.44 3.17e-73 221.0
Fso8g00347 WGDA 212 343 Chloroplast and Mitochondria gene family AT1G72820 68.182 1.23e-56 177.0
Fso8g00457 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 61.413 5.56e-70 209.0
Fso8g00949 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.375 3.87e-151 420.0
Fso8g01273 . 41 270 Chloroplast and Mitochondria gene family AT4G03320 37.037 3.57e-44 149.0
Fso8g01647 ACH,WGDA 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.583 8.24e-146 405.0
Fso8g01703 . 37 318 Chloroplast and Mitochondria gene family AT1G07030 32.042 1.22e-32 122.0
Fso8g01935 . 12 327 Chloroplast and Mitochondria gene family AT1G25380 64.174 6.00e-140 399.0
Fso9g00112 . 41 324 Chloroplast and Mitochondria gene family AT1G07030 32.867 6.91e-35 127.0
Fso9g00271 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 67.669 9.50e-122 346.0
Fso9g00471 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 4.34e-76 229.0
Fso9g01351 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 32.143 5.92e-33 127.0
Fso10g01649 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.41e-171 472.0
Fso10g01650 WGDA 1 144 Chloroplast and Mitochondria gene family AT1G29930 85.517 4.50e-85 249.0
Fso10g02395 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.075 0.0 565.0
Fso10g02563 . 1 297 Chloroplast and Mitochondria gene family AT2G17270 69.36 8.41e-162 451.0
Fso10g02581 . 1 297 Chloroplast and Mitochondria gene family AT2G17270 69.36 8.41e-162 451.0
Fso10g02989 . 12 320 Chloroplast and Mitochondria gene family AT5G15640 76.375 5.20e-180 498.0
Fso10g02990 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 72.293 8.80e-175 485.0
Fso10g03405 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.392 1.07e-154 431.0
Fso10g03406 . 2 64 Chloroplast and Mitochondria gene family AT4G10340 58.462 6.37e-07 43.1
Fso10g03479 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.606 8.24e-61 191.0
Fso10g03864 . 1 361 Chloroplast and Mitochondria gene family AT5G14040 70.083 0.0 505.0
Fso11g01094 ACH,WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 7.02e-180 493.0
Fso12g00298 ACH 2 211 Chloroplast and Mitochondria gene family AT4G25570 38.571 1.22e-54 173.0
Fso12g00402 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 1.65e-171 472.0
Fso12g01672 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 82.418 9.18e-158 439.0
Fso12g01752 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.91e-31 102.0
Fso12g01774 . 1 282 Chloroplast and Mitochondria gene family AT2G30160 68.07 3.19e-130 370.0
Fso13g00911 . 1 161 Chloroplast and Mitochondria gene family AT1G29930 82.609 1.75e-91 265.0
Fso13g00912 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.71e-167 462.0
Fso13g01431 . 2 258 Chloroplast and Mitochondria gene family AT1G15820 82.101 2.93e-151 420.0
Fso13g01476 . 54 143 Chloroplast and Mitochondria gene family AT4G25570 54.444 1.37e-25 93.6
Fso13g02031 . 1 229 Chloroplast and Mitochondria gene family AT1G72820 71.429 2.60e-112 325.0
Fso13g02032 WGDA 256 343 Chloroplast and Mitochondria gene family AT1G72820 76.136 4.51e-41 135.0
Fso14g00293 ACH 1 224 Chloroplast and Mitochondria gene family AT1G14730 59.821 7.57e-91 265.0
Fso14g00294 ACH 19 224 Chloroplast and Mitochondria gene family AT1G14730 44.66 1.40e-60 187.0
Fso14g00595 . 36 407 Chloroplast and Mitochondria gene family AT2G28800 58.333 5.21e-153 444.0
Fso14g02574 ACH 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.482 8.48e-161 447.0
Fso15g01523 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 65.789 1.32e-108 311.0
Fso15g01524 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 65.789 1.32e-108 311.0
Fso15g01997 . 84 345 Chloroplast and Mitochondria gene family AT2G28800 21.277 1.66e-07 51.6
Fso15g02345 WGDA 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 1.69e-150 419.0
Fso15g02821 . 1 236 Chloroplast and Mitochondria gene family AT1G26100 60.0 4.90e-89 261.0
Fso16g00268 . 33 294 Chloroplast and Mitochondria gene family AT2G47490 28.571 3.41e-28 110.0
Fso16g00652 ACH,WGDA 5 373 Chloroplast and Mitochondria gene family AT5G14040 76.152 0.0 575.0
Fso16g00677 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 83.388 1.74e-178 493.0
Fso16g00999 WGDA 133 309 Chloroplast and Mitochondria gene family AT1G25380 36.957 4.16e-34 123.0
Fso16g01308 WGDA 33 294 Chloroplast and Mitochondria gene family AT1G25380 29.225 2.72e-12 65.1
Fso17g00449 . 1 300 Chloroplast and Mitochondria gene family AT4G25700 64.396 5.70e-144 406.0
Fso17g01097 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.993 0.0 515.0
Fso17g01464 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.333 2.60e-154 430.0
Fso17g01833 . 35 307 Chloroplast and Mitochondria gene family AT5G40810 90.146 5.69e-173 480.0
Fso18g00021 . 42 327 Chloroplast and Mitochondria gene family AT1G76570 78.671 3.44e-176 488.0
Fso18g01752 WGDA 33 294 Chloroplast and Mitochondria gene family AT1G25380 27.402 9.16e-12 63.5
Fso18g01989 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.842 5.57e-47 158.0
Fso18g02165 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.982 2.86e-114 324.0
Fso18g02333 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.839 0.0 508.0
Fso18g02361 WGDA 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.075 0.0 568.0
Fso18g03057 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 65.272 1.79e-111 318.0
Fso10000291.1g00003 . 70 354 Chloroplast and Mitochondria gene family AT5G54290 79.649 7.30e-145 412.0
Fso10000493.1g00007 . 4 580 Chloroplast and Mitochondria gene family AT4G21490 67.241 0.0 814.0
Fso10001015.1g00003 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 8.27e-171 470.0
Fso10000815.1g00001 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.908 7.67e-175 487.0