AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Ftr2g00770 ATGGCCGCTGATGCCTACGCCCCCACTTCGTTCCCGATTCTCTGTAATGCTGCTGCTGGTGCTTCCGCTGGGGTTATTGCGGCTACATTTGTGTGTCCTTTAGATGTGATCAAGACTAGGTTTCAGGTTCATGGTCTTCCGCAGCTTAATGGTGGAACCGTGAGAGGTAGTCTTATAGTAGGTAGCTTAGAACAGATTTTTCGGAAGGAAGGGGTGCGCGGGTTGTACCGTGGGCTTTCTCCTACTATTCTTGCATTGCTTCCAAACTGGGCGGTTTATTTTACTATCTACGAGCAGCTCAAACGTCTGCTTGGCTCTGATGGAATTCATGGCCTGTCTTTTGGTGCCAATATGGTAGCTGCTTCAGGGGCTGGAGCTGCAACAACCATTGTGACAAATCCTTTGTGGGTTGTGAAGACAAGGCTGCAAACTCAAAGAATGAGAGCAGGCCTGATACCATATAGGGGTACACTATCAGCTTTGAGAAAAATTGCTCATGAAGAGGGTATTCGTGGCTTATACAGTGGTCTAGTACCTGCACTGGTCGGCATTAGTCATGTAGCTATCCAATTTCCAGCTTATGAGAAGATCAAAATCTATTTGGCTAGTAGAGAGGGTACCACAGCTGATAAACTTGGTGCTCGTGATGTCGCTGTTGCTTCTTCTGTTTCAAAAATATTTGCATCCACTTTAACATATCCACATGAGGTTGTTAGGTCAAGGCTGCAAGAGCAAGGGCACCATTCTGAAAAGAGGTACTCGGGAATGGTTGATTGCATAAAGAAAGTATTTGCAAAAGAAGGGCTTCCTGGGTTCTACCGCGGTTGTGCTACAAACCTGTTCAGGACAACCCCTGCTGCTGTTATAACATTTACCAGCTTTGAAATGATTCACCGGTTTCTTGTCACTTTATTCCCTTCTGACCCTCAACCTCACACATTATGA 945 45.93 MAADAYAPTSFPILCNAAAGASAGVIAATFVCPLDVIKTRFQVHGLPQLNGGTVRGSLIVGSLEQIFRKEGVRGLYRGLSPTILALLPNWAVYFTIYEQLKRLLGSDGIHGLSFGANMVAASGAGAATTIVTNPLWVVKTRLQTQRMRAGLIPYRGTLSALRKIAHEEGIRGLYSGLVPALVGISHVAIQFPAYEKIKIYLASREGTTADKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYSGMVDCIKKVFAKEGLPGFYRGCATNLFRTTPAAVITFTSFEMIHRFLVTLFPSDPQPHTL 314
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Ftr2g00770 314 PRINTS Mitochondrial carrier protein signature 16 29 IPR002067 GO:0055085(InterPro)
Ftr2g00770 314 PRINTS Mitochondrial carrier protein signature 127 145 IPR002067 GO:0055085(InterPro)
Ftr2g00770 314 PRINTS Mitochondrial carrier protein signature 29 43 IPR002067 GO:0055085(InterPro)
Ftr2g00770 314 PRINTS Mitochondrial carrier protein signature 78 98 IPR002067 GO:0055085(InterPro)
Ftr2g00770 314 PRINTS Mitochondrial carrier protein signature 221 243 IPR002067 GO:0055085(InterPro)
Ftr2g00770 314 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 13 305 IPR044712 GO:0006862(InterPro)|GO:0022857(PANTHER)|GO:0035352(PANTHER)|GO:0051724(PANTHER)|GO:0055085(PANTHER)|GO:0055085(InterPro)
Ftr2g00770 314 Pfam Mitochondrial carrier protein 218 302 IPR018108 -
Ftr2g00770 314 Pfam Mitochondrial carrier protein 112 202 IPR018108 -
Ftr2g00770 314 Pfam Mitochondrial carrier protein 12 106 IPR018108 -
Ftr2g00770 314 SUPERFAMILY Mitochondrial carrier 11 296 IPR023395 -
Ftr2g00770 314 FunFam Nicotinamide adenine dinucleotide transporter 1, chloroplastic 4 109 - -
Ftr2g00770 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 212 300 IPR018108 -
Ftr2g00770 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 112 200 IPR018108 -
Ftr2g00770 314 ProSiteProfiles Solute carrier (Solcar) repeat profile. 11 103 IPR018108 -
Ftr2g00770 314 Gene3D Mitochondrial carrier domain 3 108 IPR023395 -
Ftr2g00770 314 FunFam NAD+ transporter 110 305 - -
Ftr2g00770 314 Gene3D Mitochondrial carrier domain 109 303 IPR023395 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Ftr2g00770 K15115 solute carrier family 25 (mitochondrial folate transporter), member 32
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
2818021 Ftr Ftr2g00770 Ftr-Chr2:14349780 Ftr6g02085 Ftr-Chr6:85698339
2846104 Ftr Ftr13g02225 Ftr-Chr13:74292595 Ftr2g00770 Ftr-Chr2:14349780
2846108 Ftr Ftr13g02370 Ftr-Chr13:76922006 Ftr2g00770 Ftr-Chr2:14349780
2846344 Ftr Ftr18g01967 Ftr-Chr18:71029336 Ftr2g00770 Ftr-Chr2:14349780
3016763 Ftr Ftr18g01214 Ftr-Chr18:57893803 Ftr2g00770 Ftr-Chr2:14349780
3026917 Ftr Ftr2g00742 Ftr-Chr2:13817992 Ftr2g00770 Ftr-Chr2:14349780
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Ftr1g00023 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.212 2.15e-160 446.0
Ftr1g02611 . 21 224 Chloroplast and Mitochondria gene family AT1G14730 43.415 8.57e-57 178.0
Ftr2g00195 . 322 405 Chloroplast and Mitochondria gene family AT2G28800 76.19 4.02e-36 127.0
Ftr2g00196 . 51 251 Chloroplast and Mitochondria gene family AT2G28800 77.184 1.74e-104 310.0
Ftr2g00271 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 69.817 1.21e-165 462.0
Ftr2g00742 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.299 1.96e-164 458.0
Ftr2g00770 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.299 1.96e-164 458.0
Ftr2g00808 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.087 1.48e-30 117.0
Ftr3g00159 . 1 84 Chloroplast and Mitochondria gene family AT2G30160 52.381 7.25e-25 95.9
Ftr3g00280 . 44 330 Chloroplast and Mitochondria gene family AT5G54290 73.196 4.63e-134 384.0
Ftr3g00339 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 69.482 0.0 538.0
Ftr3g01038 . 1 52 Chloroplast and Mitochondria gene family AT2G30160 55.769 4.10e-14 64.3
Ftr4g00354 WGDA 35 267 Chloroplast and Mitochondria gene family AT1G29930 90.171 2.11e-155 430.0
Ftr4g00356 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 2.02e-170 469.0
Ftr4g00889 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 67.317 3.42e-101 294.0
Ftr4g01386 . 65 548 Chloroplast and Mitochondria gene family AT2G18710 84.711 0.0 835.0
Ftr4g02177 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 63.889 6.30e-33 106.0
Ftr4g02214 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 62.751 2.17e-142 405.0
Ftr4g02792 . 7 124 Chloroplast and Mitochondria gene family AT1G07020 40.164 1.38e-12 60.8
Ftr4g03704 . 1 93 Chloroplast and Mitochondria gene family AT1G61520 71.277 3.07e-32 111.0
Ftr5g00121 ACH 1 109 Chloroplast and Mitochondria gene family AT5G14040 48.624 1.20e-24 94.0
Ftr6g00265 . 4 211 Chloroplast and Mitochondria gene family AT4G25570 38.942 5.53e-55 174.0
Ftr6g00337 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 1.08e-171 473.0
Ftr6g02050 . 13 97 Chloroplast and Mitochondria gene family AT3G08940 74.419 7.73e-41 132.0
Ftr6g02125 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.91e-31 102.0
Ftr7g01887 ACH 151 228 Chloroplast and Mitochondria gene family AT5G38630 60.256 1.36e-28 102.0
Ftr7g01888 . 1 95 Chloroplast and Mitochondria gene family AT5G38630 65.263 4.83e-37 122.0
Ftr7g02334 . 84 354 Chloroplast and Mitochondria gene family AT2G28800 20.275 4.10e-06 46.6
Ftr8g00954 . 169 266 Chloroplast and Mitochondria gene family AT3G27690 88.776 2.29e-61 186.0
Ftr8g00955 WGDA 1 73 Chloroplast and Mitochondria gene family AT2G05100 80.822 1.80e-37 125.0
Ftr9g01502 . 2 258 Chloroplast and Mitochondria gene family AT1G15820 82.101 2.46e-151 420.0
Ftr9g02128 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.304 2.12e-171 478.0
Ftr10g00054 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 65.272 8.04e-111 316.0
Ftr10g00669 ACH,WGDA 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.344 0.0 577.0
Ftr10g00698 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.516 0.0 504.0
Ftr10g00839 ACH 20 228 Chloroplast and Mitochondria gene family AT5G38630 69.856 1.30e-109 312.0
Ftr10g00940 . 1 48 Chloroplast and Mitochondria gene family AT2G30160 54.167 2.20e-11 57.4
Ftr10g00946 . 1 121 Chloroplast and Mitochondria gene family AT2G30160 58.678 6.27e-46 149.0
Ftr10g00997 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.491 3.82e-46 156.0
Ftr10g01224 . 33 294 Chloroplast and Mitochondria gene family AT1G25380 27.402 2.83e-12 65.1
Ftr10g03185 . 42 294 Chloroplast and Mitochondria gene family AT1G76570 78.656 1.84e-154 433.0
Ftr12g00042 . 1 160 Chloroplast and Mitochondria gene family AT2G30160 61.875 2.07e-66 203.0
Ftr12g01828 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 3.58e-171 471.0
Ftr12g01829 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 3.62e-170 469.0
Ftr12g02559 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 75.538 0.0 563.0
Ftr12g02708 . 1 308 Chloroplast and Mitochondria gene family AT2G17270 67.532 5.83e-163 454.0
Ftr12g03104 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 75.478 0.0 500.0
Ftr12g03105 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 71.656 2.14e-174 484.0
Ftr12g03451 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.039 4.49e-154 430.0
Ftr12g03514 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.606 1.31e-60 190.0
Ftr12g03891 ACH 61 365 Chloroplast and Mitochondria gene family AT5G14040 78.033 0.0 504.0
Ftr12g04115 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.908 4.58e-172 480.0
Ftr13g00366 WGDA 1 193 Chloroplast and Mitochondria gene family AT1G72820 66.327 2.63e-84 251.0
Ftr13g00367 WGDA 212 343 Chloroplast and Mitochondria gene family AT1G72820 65.185 1.09e-53 170.0
Ftr13g00450 . 8 187 Chloroplast and Mitochondria gene family AT1G17530 62.088 7.30e-70 209.0
Ftr13g01923 . 95 239 Chloroplast and Mitochondria gene family AT3G54890 93.103 1.23e-97 279.0
Ftr13g01924 . 1 76 Chloroplast and Mitochondria gene family AT3G54890 66.234 3.15e-24 89.4
Ftr13g01957 . 37 318 Chloroplast and Mitochondria gene family AT1G07030 32.042 8.12e-33 122.0
Ftr13g02225 . 12 294 Chloroplast and Mitochondria gene family AT1G25380 67.018 3.99e-129 370.0
Ftr14g00878 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 1.05e-178 490.0
Ftr15g00338 . 1 183 Chloroplast and Mitochondria gene family AT2G30160 59.016 7.25e-71 217.0
Ftr15g02248 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 7.34e-151 420.0
Ftr15g02355 WGDA 6 394 Chloroplast and Mitochondria gene family AT4G21490 68.367 0.0 548.0
Ftr16g00158 . 36 307 Chloroplast and Mitochondria gene family AT5G40810 89.416 2.77e-170 473.0
Ftr16g00514 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 82.27 1.28e-151 423.0
Ftr16g00906 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.971 0.0 519.0
Ftr17g00108 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 32.857 2.72e-34 125.0
Ftr17g00264 . 6 94 Chloroplast and Mitochondria gene family AT1G29930 52.174 2.17e-24 91.3
Ftr17g00265 . 106 265 Chloroplast and Mitochondria gene family AT2G05100 73.62 1.22e-77 230.0
Ftr17g00502 . 102 255 Chloroplast and Mitochondria gene family AT3G61470 51.948 2.79e-50 159.0
Ftr18g01214 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.544 2.27e-48 162.0
Ftr18g01399 . 1 103 Chloroplast and Mitochondria gene family AT2G30160 57.282 1.24e-34 121.0
Ftr18g01545 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.194 0.0 506.0
Ftr18g01567 ACH,WGDA 5 374 Chloroplast and Mitochondria gene family AT5G14040 76.757 0.0 580.0
Ftr18g01967 . 33 290 Chloroplast and Mitochondria gene family AT2G47490 28.621 9.34e-28 108.0
Ftr10000282.1g00002 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 67.317 3.42e-101 294.0
Ftr10000751.1g00030 . 1 236 Chloroplast and Mitochondria gene family AT1G26100 60.241 4.33e-86 254.0