AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Ftr4g00889 ATGGCTTTCACCATTGCTTCCACCTCCCATTCATCCCTCCCAACAAGGGGGAAATTCATCACAAAACTACCTTCTGCAGAAAGGAGTTGTACTCCAAGGTACATGTTCAGAAGCACCCATGGACTTCAGAAGCTCAAAGCAGCTAAAGAAGGTGTATCAAGTGTATGTGAACCACTTCCTGCAGATAGACCAGTATGGTTCCCAGGAACCTCACCTCCTGAATGGCTAGATGGAAGCCTCCCTGGAGATTTTGGCTTTGACCCACTTGGATTAGGGTCTGATCCTGAATTACTCAAGTGGTTTGCACAAGCTGAGTTGATGCATAGCAGATGGGCAATGCTTGCAGTTGCTGGTATTTTGATACCAGAATGGCTAGAAAGTATGGGCTTTATCGACGATTTCTCGTGGTTCGAAGCGGGCTCTAGAGAGTACTTTGCGGATCCAACCACTTTATTTGTGGTGCAAATGGCGTTGATGGGTTGGGTGGAGGGTCGAAGATGGGCTGACATAATCAACCCTGGGTGCGTTGACGTCGAGCCTAATCTTCCCAATAAGAAGAAACCAAAGCCCGATGTAGGGTACCCAGGGGGATTGTGGTTTGACCCGTTTATGTGGGGAAGAGGTTCCCCAGAACCAGTGATGGTTCTGAGGACCAAAGAGATAAAGAATGGGCGGCTAGCCATGCTGGCTTTTGCAGGTTTTGTGTTCCAAGCCATTTACACTGGGCAAGGACCCCTTGAGAACCTATCGGCTCACCTTGCGGACCCTGGCCATGTCAACATTTTCTCGGCCTTCAGCACCCAAATTAAATGA 813 48.83 MAFTIASTSHSSLPTRGKFITKLPSAERSCTPRYMFRSTHGLQKLKAAKEGVSSVCEPLPADRPVWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWLESMGFIDDFSWFEAGSREYFADPTTLFVVQMALMGWVEGRRWADIINPGCVDVEPNLPNKKKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFAGFVFQAIYTGQGPLENLSAHLADPGHVNIFSAFSTQIK 270
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Ftr4g00889 270 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 39 262 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Ftr4g00889 270 SUPERFAMILY Chlorophyll a-b binding protein 62 265 - -
Ftr4g00889 270 FunFam Chlorophyll a-b binding protein, chloroplastic 73 258 - -
Ftr4g00889 270 Gene3D Chlorophyll a-b binding protein domain 73 258 - -
Ftr4g00889 270 Pfam Chlorophyll A-B binding protein 72 239 IPR022796 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Ftr4g00889 K08908 light-harvesting complex I chlorophyll a/b binding protein 2
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Ftr Ftr-Chr15:82763342 Ftr4g00889 Ftr-Chr4:10777567 dispersed
Ftr Ftr-Chr17:13185659 Ftr4g00889 Ftr-Chr4:10777567 dispersed
Ftr Ftr-Chr4:10777567 Ftr9g01502 Ftr-Chr9:71830624 dispersed
Ftr Ftr-Chr4:10777567 Ftr12g03514 Ftr-Chr12:100564993 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Ftr1g00023 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.212 2.15e-160 446.0
Ftr1g02611 . 21 224 Chloroplast and Mitochondria gene family AT1G14730 43.415 8.57e-57 178.0
Ftr2g00195 . 322 405 Chloroplast and Mitochondria gene family AT2G28800 76.19 4.02e-36 127.0
Ftr2g00196 . 51 251 Chloroplast and Mitochondria gene family AT2G28800 77.184 1.74e-104 310.0
Ftr2g00271 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 69.817 1.21e-165 462.0
Ftr2g00742 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.299 1.96e-164 458.0
Ftr2g00770 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.299 1.96e-164 458.0
Ftr2g00808 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.087 1.48e-30 117.0
Ftr3g00159 . 1 84 Chloroplast and Mitochondria gene family AT2G30160 52.381 7.25e-25 95.9
Ftr3g00280 . 44 330 Chloroplast and Mitochondria gene family AT5G54290 73.196 4.63e-134 384.0
Ftr3g00339 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 69.482 0.0 538.0
Ftr3g01038 . 1 52 Chloroplast and Mitochondria gene family AT2G30160 55.769 4.10e-14 64.3
Ftr4g00354 WGDA 35 267 Chloroplast and Mitochondria gene family AT1G29930 90.171 2.11e-155 430.0
Ftr4g00356 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 2.02e-170 469.0
Ftr4g00889 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 67.317 3.42e-101 294.0
Ftr4g01386 . 65 548 Chloroplast and Mitochondria gene family AT2G18710 84.711 0.0 835.0
Ftr4g02177 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 63.889 6.30e-33 106.0
Ftr4g02214 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 62.751 2.17e-142 405.0
Ftr4g02792 . 7 124 Chloroplast and Mitochondria gene family AT1G07020 40.164 1.38e-12 60.8
Ftr4g03704 . 1 93 Chloroplast and Mitochondria gene family AT1G61520 71.277 3.07e-32 111.0
Ftr5g00121 ACH 1 109 Chloroplast and Mitochondria gene family AT5G14040 48.624 1.20e-24 94.0
Ftr6g00265 . 4 211 Chloroplast and Mitochondria gene family AT4G25570 38.942 5.53e-55 174.0
Ftr6g00337 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 1.08e-171 473.0
Ftr6g02050 . 13 97 Chloroplast and Mitochondria gene family AT3G08940 74.419 7.73e-41 132.0
Ftr6g02125 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.91e-31 102.0
Ftr7g01887 ACH 151 228 Chloroplast and Mitochondria gene family AT5G38630 60.256 1.36e-28 102.0
Ftr7g01888 . 1 95 Chloroplast and Mitochondria gene family AT5G38630 65.263 4.83e-37 122.0
Ftr7g02334 . 84 354 Chloroplast and Mitochondria gene family AT2G28800 20.275 4.10e-06 46.6
Ftr8g00954 . 169 266 Chloroplast and Mitochondria gene family AT3G27690 88.776 2.29e-61 186.0
Ftr8g00955 WGDA 1 73 Chloroplast and Mitochondria gene family AT2G05100 80.822 1.80e-37 125.0
Ftr9g01502 . 2 258 Chloroplast and Mitochondria gene family AT1G15820 82.101 2.46e-151 420.0
Ftr9g02128 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.304 2.12e-171 478.0
Ftr10g00054 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 65.272 8.04e-111 316.0
Ftr10g00669 ACH,WGDA 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.344 0.0 577.0
Ftr10g00698 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.516 0.0 504.0
Ftr10g00839 ACH 20 228 Chloroplast and Mitochondria gene family AT5G38630 69.856 1.30e-109 312.0
Ftr10g00940 . 1 48 Chloroplast and Mitochondria gene family AT2G30160 54.167 2.20e-11 57.4
Ftr10g00946 . 1 121 Chloroplast and Mitochondria gene family AT2G30160 58.678 6.27e-46 149.0
Ftr10g00997 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.491 3.82e-46 156.0
Ftr10g01224 . 33 294 Chloroplast and Mitochondria gene family AT1G25380 27.402 2.83e-12 65.1
Ftr10g03185 . 42 294 Chloroplast and Mitochondria gene family AT1G76570 78.656 1.84e-154 433.0
Ftr12g00042 . 1 160 Chloroplast and Mitochondria gene family AT2G30160 61.875 2.07e-66 203.0
Ftr12g01828 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 3.58e-171 471.0
Ftr12g01829 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 3.62e-170 469.0
Ftr12g02559 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 75.538 0.0 563.0
Ftr12g02708 . 1 308 Chloroplast and Mitochondria gene family AT2G17270 67.532 5.83e-163 454.0
Ftr12g03104 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 75.478 0.0 500.0
Ftr12g03105 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 71.656 2.14e-174 484.0
Ftr12g03451 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.039 4.49e-154 430.0
Ftr12g03514 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.606 1.31e-60 190.0
Ftr12g03891 ACH 61 365 Chloroplast and Mitochondria gene family AT5G14040 78.033 0.0 504.0
Ftr12g04115 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.908 4.58e-172 480.0
Ftr13g00366 WGDA 1 193 Chloroplast and Mitochondria gene family AT1G72820 66.327 2.63e-84 251.0
Ftr13g00367 WGDA 212 343 Chloroplast and Mitochondria gene family AT1G72820 65.185 1.09e-53 170.0
Ftr13g00450 . 8 187 Chloroplast and Mitochondria gene family AT1G17530 62.088 7.30e-70 209.0
Ftr13g01923 . 95 239 Chloroplast and Mitochondria gene family AT3G54890 93.103 1.23e-97 279.0
Ftr13g01924 . 1 76 Chloroplast and Mitochondria gene family AT3G54890 66.234 3.15e-24 89.4
Ftr13g01957 . 37 318 Chloroplast and Mitochondria gene family AT1G07030 32.042 8.12e-33 122.0
Ftr13g02225 . 12 294 Chloroplast and Mitochondria gene family AT1G25380 67.018 3.99e-129 370.0
Ftr14g00878 WGDA 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 1.05e-178 490.0
Ftr15g00338 . 1 183 Chloroplast and Mitochondria gene family AT2G30160 59.016 7.25e-71 217.0
Ftr15g02248 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 7.34e-151 420.0
Ftr15g02355 WGDA 6 394 Chloroplast and Mitochondria gene family AT4G21490 68.367 0.0 548.0
Ftr16g00158 . 36 307 Chloroplast and Mitochondria gene family AT5G40810 89.416 2.77e-170 473.0
Ftr16g00514 WGDA 2 280 Chloroplast and Mitochondria gene family AT4G10340 82.27 1.28e-151 423.0
Ftr16g00906 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.971 0.0 519.0
Ftr17g00108 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 32.857 2.72e-34 125.0
Ftr17g00264 . 6 94 Chloroplast and Mitochondria gene family AT1G29930 52.174 2.17e-24 91.3
Ftr17g00265 . 106 265 Chloroplast and Mitochondria gene family AT2G05100 73.62 1.22e-77 230.0
Ftr17g00502 . 102 255 Chloroplast and Mitochondria gene family AT3G61470 51.948 2.79e-50 159.0
Ftr18g01214 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.544 2.27e-48 162.0
Ftr18g01399 . 1 103 Chloroplast and Mitochondria gene family AT2G30160 57.282 1.24e-34 121.0
Ftr18g01545 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.194 0.0 506.0
Ftr18g01567 ACH,WGDA 5 374 Chloroplast and Mitochondria gene family AT5G14040 76.757 0.0 580.0
Ftr18g01967 . 33 290 Chloroplast and Mitochondria gene family AT2G47490 28.621 9.34e-28 108.0
Ftr10000282.1g00002 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 67.317 3.42e-101 294.0
Ftr10000751.1g00030 . 1 236 Chloroplast and Mitochondria gene family AT1G26100 60.241 4.33e-86 254.0