AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Glco3g01021 ATGGCAACACAAGCTTTGGTCTCATCATCATCACTCACATCCTCTGTTGAGTCTGCTAGACAAATCCTTGGTGCTAGACCAGCTTTCACACCTACAAGAAAAGTTTCATTTCTTGTCAAAGCTGCTTCCACACCTCCTGTTAAGCAAGGAGACAGACAACTATGGTTTGCATCCAAGCAATCTCTTTCTTACCTGGATGGAACTCTCCCAGGTGACTTTGGATTCGACCCACTTGGTCTTTCTGACCCAGAAGGGACCGGAGGATTCATTGAACCCAAATGGCTAGCTTACGGAGAGGTTATCAATGGACGGTTTGCCATGTTGGGTGCAGCCGGAGCTATTGCACCAGAAATTCTAGGAAAGCTTGGACTCATCCCAGCCGAAACTGCCCTTCCCTGGTTCAAGACCGGTGTCATCCCCCCAGCCGGCACATACAACTACTGGGCTGACCCTTTCACCCTATTTGTATTAGAAATGGCACTTATGGGCTTTGCAGAACACAGAAGACTACAAGATTGGTACAACCCAGGATCAATGGGAAAACAATACTTTTTGGGTTTGGAAAAAGGGTTTTCAGGATCCGGCGACCCAGCATACCCAGGTGGCCCGTTCTTTAACCCTCTTGGGTTCGGTAAAGATGAGAAGTCGATGAAGGAACTGAAGCTAAAGGAGATCAAGAACGGTAGATTGGCTATGTTGGCTGTCTTAGGTTACTTCATTCAGGGTTTGGTGACTGGGGTTGGACCTTTTGAGAACCTTTTGGATCATTTGGCTGATCCTGTCAACAACAATGTCTTGACCAGCCTTAAGTTCCACTAG 819 47.25 MATQALVSSSSLTSSVESARQILGARPAFTPTRKVSFLVKAASTPPVKQGDRQLWFASKQSLSYLDGTLPGDFGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEILGKLGLIPAETALPWFKTGVIPPAGTYNYWADPFTLFVLEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAVLGYFIQGLVTGVGPFENLLDHLADPVNNNVLTSLKFH 272
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Glco3g01021 272 Gene3D Chlorophyll a-b binding protein domain 53 271 - -
Glco3g01021 272 Pfam Chlorophyll A-B binding protein 63 242 IPR022796 -
Glco3g01021 272 SUPERFAMILY Chlorophyll a-b binding protein 51 268 - -
Glco3g01021 272 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 5 267 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Glco3g01021 272 FunFam Chlorophyll a-b binding protein, chloroplastic 53 271 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Glco3g01021 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Glco Glco-Chr3:58486919 Glco3g04358 Glco-Chr3:518864958 dispersed
Glco Glco-Chr1:252870778 Glco3g01021 Glco-Chr3:58486919 transposed
Glco Glco-Chr5:4136223 Glco3g01021 Glco-Chr3:58486919 transposed
Glco Glco-Chr5:380330734 Glco3g01021 Glco-Chr3:58486919 transposed
Glco Glco-Chr6:66531601 Glco3g01021 Glco-Chr3:58486919 transposed
Glco Glco-Chr7:574817520 Glco3g01021 Glco-Chr3:58486919 transposed
Glco Glco-Chr8:490366573 Glco3g01021 Glco-Chr3:58486919 transposed
Glco Glco-Chr9:41683820 Glco3g01021 Glco-Chr3:58486919 transposed
Glco Glco-Chr3:58486919 Glco9g03033 Glco-Chr9:415610262 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Glco1g00380 . 19 142 Chloroplast and Mitochondria gene family AT1G72820 69.355 1.58e-51 164.0
Glco1g00381 . 19 142 Chloroplast and Mitochondria gene family AT1G72820 69.355 1.58e-51 164.0
Glco1g00382 . 245 345 Chloroplast and Mitochondria gene family AT1G72820 66.337 6.38e-39 132.0
Glco1g02467 . 10 65 Chloroplast and Mitochondria gene family AT4G21490 46.552 1.59e-11 56.2
Glco1g02772 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 88.789 3.69e-147 410.0
Glco1g03203 ACH 33 317 Chloroplast and Mitochondria gene family AT1G25380 67.361 2.30e-140 400.0
Glco1g03521 ACH 8 222 Chloroplast and Mitochondria gene family AT1G14730 43.578 3.02e-56 177.0
Glco1g03522 ACH 8 223 Chloroplast and Mitochondria gene family AT1G14730 61.574 4.32e-91 265.0
Glco1g03816 . 33 303 Chloroplast and Mitochondria gene family AT1G25380 28.904 1.76e-13 68.6
Glco1g03871 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 1.42e-169 467.0
Glco1g04986 . 5 327 Chloroplast and Mitochondria gene family AT2G30160 69.725 3.66e-155 436.0
Glco1g05065 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 2.94e-35 112.0
Glco1g06133 . 13 307 Chloroplast and Mitochondria gene family AT2G47490 77.517 3.22e-159 445.0
Glco1g07810 . 38 327 Chloroplast and Mitochondria gene family AT1G76570 76.552 4.94e-173 481.0
Glco2g01662 . 29 300 Chloroplast and Mitochondria gene family AT4G25700 68.531 1.91e-142 402.0
Glco2g03633 . 2 320 Chloroplast and Mitochondria gene family AT5G15640 77.116 0.0 507.0
Glco2g04878 . 32 280 Chloroplast and Mitochondria gene family AT4G10340 88.0 8.11e-147 410.0
Glco2g04879 . 3 280 Chloroplast and Mitochondria gene family AT4G10340 85.305 6.41e-154 429.0
Glco2g05075 . 37 250 Chloroplast and Mitochondria gene family AT3G61470 47.465 1.83e-63 198.0
Glco2g05652 . 41 255 Chloroplast and Mitochondria gene family AT3G61470 52.558 3.67e-74 224.0
Glco2g06281 ACH 70 367 Chloroplast and Mitochondria gene family AT5G14040 78.859 8.28e-178 496.0
Glco2g07035 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.079 6.46e-170 475.0
Glco3g00422 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 84.27 9.22e-166 457.0
Glco3g01021 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.109 6.74e-166 458.0
Glco3g02242 . 226 247 Chloroplast and Mitochondria gene family AT5G40810 86.364 6.99e-07 40.0
Glco3g03329 . 45 548 Chloroplast and Mitochondria gene family AT2G18710 82.574 0.0 844.0
Glco3g04358 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 68.599 7.44e-105 303.0
Glco3g06178 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.104 1.67e-170 469.0
Glco3g06179 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 9.50e-171 470.0
Glco3g06180 . 1 162 Chloroplast and Mitochondria gene family AT1G29930 87.117 1.56e-99 286.0
Glco3g06181 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.51e-171 472.0
Glco3g06182 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 8.70e-172 473.0
Glco3g06183 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 6.84e-173 476.0
Glco3g06184 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 89.179 1.49e-173 477.0
Glco3g06185 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 6.84e-173 476.0
Glco3g06186 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 3.78e-173 476.0
Glco3g06187 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 1.68e-172 474.0
Glco3g06188 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 89.179 1.59e-173 477.0
Glco4g03318 . 18 316 Chloroplast and Mitochondria gene family AT1G07030 29.236 1.46e-30 120.0
Glco4g05642 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 1.17e-165 457.0
Glco4g06070 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 76.022 0.0 561.0
Glco5g00116 . 127 266 Chloroplast and Mitochondria gene family AT2G34430 87.143 2.51e-84 246.0
Glco5g00500 . 1 90 Chloroplast and Mitochondria gene family AT1G29930 66.667 9.58e-36 120.0
Glco5g04274 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 5.30e-169 466.0
Glco5g04810 . 3 143 Chloroplast and Mitochondria gene family AT1G07020 51.408 1.18e-30 106.0
Glco5g05461 . 7 187 Chloroplast and Mitochondria gene family AT1G17530 61.326 4.82e-73 216.0
Glco6g01196 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.041 3.96e-122 347.0
Glco6g01460 ACH 1 371 Chloroplast and Mitochondria gene family AT5G14040 72.776 0.0 554.0
Glco6g01806 . 34 255 Chloroplast and Mitochondria gene family AT3G61470 51.802 2.07e-74 225.0
Glco6g02940 . 12 311 Chloroplast and Mitochondria gene family AT2G47490 28.045 2.83e-28 110.0
Glco7g01264 . 1 73 Chloroplast and Mitochondria gene family AT1G15820 55.263 5.76e-17 70.9
Glco7g01483 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 64.192 1.80e-106 305.0
Glco7g02153 . 54 356 Chloroplast and Mitochondria gene family AT5G14040 49.342 1.55e-99 296.0
Glco7g02155 ACH 5 373 Chloroplast and Mitochondria gene family AT5G14040 78.649 0.0 578.0
Glco7g02362 . 9 236 Chloroplast and Mitochondria gene family AT1G26100 66.667 5.97e-98 284.0
Glco7g02461 ACH 33 319 Chloroplast and Mitochondria gene family AT1G25380 67.586 6.04e-144 408.0
Glco7g02867 . 1 305 Chloroplast and Mitochondria gene family AT2G17270 64.918 1.20e-157 440.0
Glco7g03050 . 72 404 Chloroplast and Mitochondria gene family AT2G28800 61.756 1.18e-152 443.0
Glco7g04221 . 1 100 Chloroplast and Mitochondria gene family AT1G29930 76.0 7.77e-48 154.0
Glco7g04220 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 4.73e-169 466.0
Glco7g04222 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 3.29e-170 469.0
Glco7g04223 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 83.895 2.76e-165 456.0
Glco7g04224 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 9.79e-169 465.0
Glco7g04225 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 3.30e-167 461.0
Glco7g04320 . 46 271 Chloroplast and Mitochondria gene family AT4G03320 36.91 1.95e-43 147.0
Glco7g05554 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.917 1.04e-144 402.0
Glco7g05983 ACH 4 258 Chloroplast and Mitochondria gene family AT1G15820 81.961 3.79e-148 412.0
Glco7g06686 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.722 2.39e-179 492.0
Glco7g06687 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 0.0 496.0
Glco7g06688 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.679 0.0 496.0
Glco7g06689 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 87.925 2.32e-180 494.0
Glco7g06690 . 106 265 Chloroplast and Mitochondria gene family AT2G05070 91.25 6.63e-108 306.0
Glco7g06691 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.057 0.0 497.0
Glco7g06823 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 86.861 2.48e-170 470.0
Glco8g00139 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 81.25 4.08e-140 391.0
Glco8g00936 . 1 215 Chloroplast and Mitochondria gene family AT4G25570 68.056 5.23e-106 304.0
Glco8g01939 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 69.298 8.07e-117 331.0
Glco8g02364 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.174 0.0 509.0
Glco8g02437 ACH 1 372 Chloroplast and Mitochondria gene family AT5G14040 75.936 0.0 571.0
Glco8g03341 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.786 2.12e-47 160.0
Glco8g03604 . 5 304 Chloroplast and Mitochondria gene family AT2G17270 67.333 3.16e-156 438.0
Glco8g05607 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 1.49e-167 462.0
Glco8g06001 ACH 4 214 Chloroplast and Mitochondria gene family AT4G25570 41.232 2.41e-54 172.0
Glco8g06002 ACH 6 214 Chloroplast and Mitochondria gene family AT4G25570 43.062 5.41e-58 181.0
Glco8g06649 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.672 4.34e-165 458.0
Glco9g00994 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 8.87e-170 468.0
Glco9g00995 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 8.87e-170 468.0
Glco9g01006 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 8.30e-169 465.0
Glco9g01882 . 43 446 Chloroplast and Mitochondria gene family AT2G28800 73.798 0.0 598.0
Glco9g03033 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.077 1.04e-146 409.0
Glco10000136.1g00005 . 37 323 Chloroplast and Mitochondria gene family AT1G07030 30.45 3.64e-32 120.0
Glco10001116.1g00011 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.537 9.39e-122 346.0
Glco10001185.1g00011 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 66.087 2.02e-156 440.0
Glco10001213.1g00008 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.565 5.05e-167 468.0
Glco10001225.1g00003 . 7 307 Chloroplast and Mitochondria gene family AT5G40810 87.171 0.0 507.0
Glco10001419.1g00002 . 1 77 Chloroplast and Mitochondria gene family AT1G15820 56.098 4.39e-16 68.6
Glco10001435.1g00012 . 13 307 Chloroplast and Mitochondria gene family AT2G47490 77.517 1.76e-159 446.0
Glco10001724.1g00003 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 28.188 4.00e-29 113.0
Glco10001967.1g00011 . 64 354 Chloroplast and Mitochondria gene family AT2G28800 21.498 3.41e-07 50.4