AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Hean11g00707 ATGGCAACACAAGCGTTGGCTTCCTCATCATCACTCACCTCCTCAGTGGAGTCTGCAAGGCAAATCCTTGGAGCTAGGCCACTTCACACGTCTTCAAGAAAGGTCTCTTTTCTTGTCAAAGCTGCATCGACCCCTCCTGTTAAGCAAGGAGCAAACAGACAACTTTGGTTTGCATCCAAGCAATCTCTTTCTTACCTGGATGGAAGTCTCCCAGGTGACTATGGATTTGACCCACTTGGTCTTTCTGACCCAGAAGGTACTGGTGGATTCATTGAACCCAAGTGGCTAGCTTATGGAGAGGTTATCAACGGTCGGTTCGCCATGTTGGGTGCAGCTGGAGCCATTGCACCTGAGATATTTGGCAAGCTTGGGCTCATCCCAGCCGAAACCGCCCTCCCGTGGTTCAAGACCGGTGTCATCCCCCCAGCGGGCACATACGACTACTGGGCAGACCCTTTCACCCTGTTTGTATTTGAAATGGCACTTATGGGTTTTGCAGAACACAGAAGACTACAAGACTGGTACAACCCTGGTTCAATGGGAAAACAATACTTTTTGGGCTTGGAGAAAGGTTTTGCCGGGTCGGGTGACCCAGCATACCCAGGTGGGCCGTTTTTCAACCCATTAGGGTTTGGAAAAGATGAGAAGTCAATGAAGGAATTGAAGCTTAAAGAGATCAAGAATGGTAGATTGGCTATGTTGGCCATTTTGGGTTACTTCATTCAGGGTTTGGTGACTGGTGTTGGACCTTTCGAGAACCTTCTGGATCACTTGGCTGATCCAGTCAACAACAATGTCTTGACCAGCCTTAAGTTCCACTAG 822 48.78 MATQALASSSSLTSSVESARQILGARPLHTSSRKVSFLVKAASTPPVKQGANRQLWFASKQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEIFGKLGLIPAETALPWFKTGVIPPAGTYDYWADPFTLFVFEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGFAGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQGLVTGVGPFENLLDHLADPVNNNVLTSLKFH 273
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Hean11g00707 273 Pfam Chlorophyll A-B binding protein 64 243 IPR022796 -
Hean11g00707 273 Gene3D Chlorophyll a-b binding protein domain 54 272 - -
Hean11g00707 273 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 14 268 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Hean11g00707 273 FunFam Chlorophyll a-b binding protein, chloroplastic 54 272 - -
Hean11g00707 273 SUPERFAMILY Chlorophyll a-b binding protein 52 269 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Hean11g00707 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Hean Hean-Chr11:14868880 Hean9g03674 Hean-Chr9:166349346 dispersed
Hean Hean-Chr11:14868880 Hean15g03880 Hean-Chr15:147143730 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Hean17g00845 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.541 7.69e-150 417.0
Hean17g02141 . 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.882 0.0 572.0
Hean17g02184 . 2 236 Chloroplast and Mitochondria gene family AT1G26100 64.754 5.84e-96 279.0
Hean17g02613 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.194 2.30e-170 469.0
Hean17g03814 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 3.88e-170 469.0
Hean17g04080 ACH,WGDA 4 211 Chloroplast and Mitochondria gene family AT4G25570 44.231 2.60e-59 185.0
Hean16g00306 . 42 307 Chloroplast and Mitochondria gene family AT5G40810 84.27 1.40e-150 420.0
Hean16g01504 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 63.889 2.92e-33 107.0
Hean16g01529 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 61.85 9.32e-144 408.0
Hean16g02347 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.226 4.30e-151 422.0
Hean16g03891 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 1.51e-170 470.0
Hean16g03892 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 82.156 1.05e-161 447.0
Hean16g04130 WGDA 18 220 Chloroplast and Mitochondria gene family AT1G14730 38.462 4.09e-43 143.0
Hean15g00023 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.307 5.38e-166 460.0
Hean15g01361 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 75.198 0.0 562.0
Hean15g01740 . 1 305 Chloroplast and Mitochondria gene family AT2G17270 65.574 1.12e-157 441.0
Hean15g01980 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 5.55e-172 473.0
Hean15g01981 . 24 267 Chloroplast and Mitochondria gene family AT1G29910 88.571 3.24e-160 444.0
Hean15g01983 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 9.09e-171 470.0
Hean15g03321 ACH,WGDA 42 307 Chloroplast and Mitochondria gene family AT3G27240 93.233 2.74e-174 481.0
Hean15g03544 . 276 315 Chloroplast and Mitochondria gene family AT5G15640 72.5 3.40e-15 66.6
Hean15g03880 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 89.011 2.38e-172 475.0
Hean15g04022 . 2 264 Chloroplast and Mitochondria gene family AT2G05070 67.286 1.01e-122 348.0
Hean15g04203 . 1 300 Chloroplast and Mitochondria gene family AT4G25700 62.651 1.14e-144 409.0
Hean14g00018 . 30 327 Chloroplast and Mitochondria gene family AT1G76570 76.589 1.04e-177 493.0
Hean14g00195 . 6 251 Chloroplast and Mitochondria gene family AT1G29930 83.333 7.84e-145 404.0
Hean14g01927 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.5 1.59e-47 160.0
Hean14g02364 . 33 294 Chloroplast and Mitochondria gene family AT1G25380 29.577 1.56e-13 68.9
Hean14g02694 ACH,WGDA 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.982 3.01e-113 322.0
Hean14g02959 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.484 0.0 508.0
Hean14g03011 ACH,WGDA 315 373 Chloroplast and Mitochondria gene family AT5G14040 81.356 7.77e-28 102.0
Hean14g03012 WGDA 2 211 Chloroplast and Mitochondria gene family AT5G14040 63.333 3.82e-82 247.0
Hean14g04307 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 65.272 2.90e-111 317.0
Hean13g00478 . 21 264 Chloroplast and Mitochondria gene family AT5G15640 62.705 1.83e-100 294.0
Hean13g03365 . 51 159 Chloroplast and Mitochondria gene family AT5G38630 60.55 4.82e-41 136.0
Hean12g00312 . 316 359 Chloroplast and Mitochondria gene family AT5G14040 63.636 7.01e-13 60.5
Hean12g00313 . 84 169 Chloroplast and Mitochondria gene family AT5G14040 39.773 3.17e-09 50.4
Hean12g00314 . 314 346 Chloroplast and Mitochondria gene family AT5G14040 69.697 4.55e-10 52.0
Hean12g00560 WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.653 2.80e-164 460.0
Hean12g00732 WGDA 7 187 Chloroplast and Mitochondria gene family AT1G17530 62.431 1.38e-72 215.0
Hean12g01222 . 33 327 Chloroplast and Mitochondria gene family AT1G25380 65.116 2.07e-140 400.0
Hean12g01802 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.917 6.18e-143 398.0
Hean12g03295 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 65.351 1.61e-108 310.0
Hean11g00548 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 82.624 1.53e-152 426.0
Hean11g00550 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 82.624 3.63e-153 427.0
Hean11g00707 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.672 1.73e-170 470.0
Hean11g02194 WGDA 51 447 Chloroplast and Mitochondria gene family AT2G28800 76.355 0.0 598.0
Hean10g00120 . 41 325 Chloroplast and Mitochondria gene family AT1G07030 32.753 4.11e-34 125.0
Hean10g00137 . 89 126 Chloroplast and Mitochondria gene family AT2G28800 63.415 2.30e-07 47.4
Hean10g00942 . 133 190 Chloroplast and Mitochondria gene family AT5G15640 74.138 2.42e-24 96.7
Hean10g01613 . 99 260 Chloroplast and Mitochondria gene family AT5G15640 68.519 5.49e-75 225.0
Hean10g01639 . 1 71 Chloroplast and Mitochondria gene family AT2G34430 67.606 1.44e-23 90.1
Hean10g02092 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.992 3.79e-151 423.0
Hean10g03185 ACH,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.845 8.66e-168 469.0
Hean10g03452 WGDA 6 187 Chloroplast and Mitochondria gene family AT1G17530 62.637 1.86e-74 220.0
Hean9g01015 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.052 2.79e-157 442.0
Hean9g02153 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.408 0.0 513.0
Hean9g03268 . 11 320 Chloroplast and Mitochondria gene family AT5G15640 69.032 2.36e-168 469.0
Hean9g03269 . 1 320 Chloroplast and Mitochondria gene family AT5G15640 73.125 3.68e-176 492.0
Hean9g03674 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.154 7.08e-61 191.0
Hean9g04384 ACH 70 362 Chloroplast and Mitochondria gene family AT5G14040 81.229 0.0 508.0
Hean9g04760 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.422 3.23e-173 483.0
Hean8g00138 . 36 407 Chloroplast and Mitochondria gene family AT2G28800 60.101 1.52e-158 458.0
Hean8g01167 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 85.0 5.32e-147 408.0
Hean8g01835 . 136 224 Chloroplast and Mitochondria gene family AT1G14730 48.315 4.34e-21 82.4
Hean8g01836 ACH 4 134 Chloroplast and Mitochondria gene family AT4G25570 52.672 8.80e-45 145.0
Hean8g01837 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 61.607 2.37e-90 263.0
Hean8g02991 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 67.528 5.20e-122 347.0
Hean8g03322 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 1.42e-75 228.0
Hean7g01228 . 5 309 Chloroplast and Mitochondria gene family AT2G17270 63.607 1.66e-148 417.0
Hean7g01363 . 74 308 Chloroplast and Mitochondria gene family AT1G25380 35.659 2.41e-38 136.0
Hean7g02342 WGDA 2 367 Chloroplast and Mitochondria gene family AT5G14040 77.596 0.0 573.0
Hean7g02344 ACH,WGDA 2 367 Chloroplast and Mitochondria gene family AT5G14040 77.596 0.0 573.0
Hean7g02375 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.516 0.0 500.0
Hean7g02591 ACH,WGDA 18 228 Chloroplast and Mitochondria gene family AT5G38630 46.919 3.36e-58 179.0
Hean7g02837 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 26.623 3.73e-28 110.0
Hean6g00840 . 4 580 Chloroplast and Mitochondria gene family AT4G21490 67.126 0.0 793.0
Hean6g01110 . 176 225 Chloroplast and Mitochondria gene family AT5G14040 72.0 1.09e-17 75.9
Hean6g01384 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.541 1.06e-149 417.0
Hean5g00648 . 38 548 Chloroplast and Mitochondria gene family AT2G18710 81.081 0.0 837.0
Hean5g01407 . 28 270 Chloroplast and Mitochondria gene family AT4G03320 36.694 6.75e-45 150.0
Hean5g02729 . 1 354 Chloroplast and Mitochondria gene family AT5G54290 67.036 1.27e-145 414.0
Hean5g02890 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 72.752 0.0 556.0
Hean5g03169 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 1.05e-75 229.0
Hean5g03433 . 169 354 Chloroplast and Mitochondria gene family AT4G21490 75.936 6.27e-90 272.0
Hean4g03128 . 270 426 Chloroplast and Mitochondria gene family AT4G21490 58.228 1.73e-53 177.0
Hean4g03563 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 3.66e-172 474.0
Hean4g03565 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 9.50e-172 473.0
Hean4g04275 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 66.184 3.53e-102 298.0
Hean3g01277 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 78.682 2.40e-146 408.0
Hean3g02170 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 90.566 0.0 499.0
Hean2g00294 . 3 145 Chloroplast and Mitochondria gene family AT1G07020 43.537 7.50e-21 80.9
Hean2g00318 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 76.374 0.0 560.0
Hean2g02142 WGDA 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.642 7.33e-33 127.0
Hean2g02432 . 99 264 Chloroplast and Mitochondria gene family AT5G15640 50.0 9.56e-40 134.0
Hean1g00065 . 33 300 Chloroplast and Mitochondria gene family AT2G47490 30.094 3.35e-31 118.0
Hean1g00088 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 77.922 1.19e-165 461.0
Hean1g00717 . 257 313 Chloroplast and Mitochondria gene family AT5G14040 70.175 5.68e-22 84.3
Hean1g00858 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 82.246 3.49e-157 439.0
Hean1g01283 WGDA 40 449 Chloroplast and Mitochondria gene family AT2G28800 73.735 0.0 605.0
Hean1g01473 . 1 329 Chloroplast and Mitochondria gene family AT2G30160 69.162 7.70e-162 453.0
Hean1g01610 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 65.278 2.46e-32 105.0
Hean1g01986 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 86.842 6.02e-169 466.0