AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Laca7g02957 ATGGCTGCAGCTGCTAGCTCTACCACCGTGGTCCGAGCCACCCCATTCTTGGGTCAAACCAGACCATCGCGTCTCAACTCTCTAAGAGATGTTGTCTCCATGCCCAGTGCCAAATTCACCATGGGAAACGACTTGTGGTACGGACCTGACCGAGTCAAGTACTTGGGACCCTTTTCCGCTCAGACCCCGTCGTACCTGACCGGCGAATTCCCCGGTGACTACGGTTGGGACACCGCCGGCTTGTCCGCTGATCCCGAGGCCTTCGCTAAGAACAGGGCTCTAGAGGTAATCCATGGGCGATGGGCCATGCTTGGTGCATTCGGATGTATCACGCCGGAGGTTCTCCAAAAGTGGGTGAAAGTTGATTTCAAGGAGCCAGTCTGGTTCAAGGCCGGAGCCCAGATTTTCTCCGAAGGTGGTCTGGACTACTTAGGAAACCCGAACCTTGTCCATGCTCAAAGCATACTGGCGGTGCTCGGATTCCAGGTGGTGTTGATGGGTCTTGTTGAAGGGTTCCGCATCAACGGTCTTGAAGGCGTTGGAGACGGTAACAACCTTTACCCCGGTGGCCAATATTTTGACCCGTTGGGGCTTGCAGATGACCCGGTGACATTTGCTGAGTTGAAGGTGAAGGAGATTAAGAATGGAAGGCTCGCAATGTTCTCCATGTTTGGGTTTTTTGTTCAAGCTATTGTTACAGGGAAGGGGCCATTGGAGAACCTATTGGACCATTTGGACAATCCTGTGGCTAACAATGCCTGGGTCTATGCCACCAAGTTTGCGCCAGGGTCATAG 795 53.46 MAAAASSTTVVRATPFLGQTRPSRLNSLRDVVSMPSAKFTMGNDLWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGAFGCITPEVLQKWVKVDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLEGVGDGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFAPGS 264
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Laca7g02957 264 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 22 263 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Laca7g02957 264 Gene3D Chlorophyll a-b binding protein domain 53 257 - -
Laca7g02957 264 Pfam Chlorophyll A-B binding protein 63 231 IPR022796 -
Laca7g02957 264 SUPERFAMILY Chlorophyll a-b binding protein 45 261 - -
Laca7g02957 264 FunFam Chlorophyll a-b binding protein, chloroplastic 53 257 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Laca7g02957 K08914 light-harvesting complex II chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Laca Laca-Chr5:7599447 Laca7g02957 Laca-Chr7:140997916 dispersed
Laca Laca-Chr7:140997916 Laca9g03360 Laca-Chr9:137691637 dispersed
Laca Laca-Chr2:1328934 Laca7g02957 Laca-Chr7:140997916 transposed
Laca Laca-Chr5:162460745 Laca7g02957 Laca-Chr7:140997916 transposed
Laca Laca-Chr9:118293296 Laca7g02957 Laca-Chr7:140997916 transposed
Laca Laca-Chr5:7556972 Laca7g02957 Laca-Chr7:140997916 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lacanog01185 . 4 188 Chloroplast and Mitochondria gene family AT1G72750 44.324 5.45e-37 124.0
Lacanog01671 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 1.21e-172 475.0
Lacanog02712 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 69.688 6.69e-172 480.0
Lacanog04426 . 1 320 Chloroplast and Mitochondria gene family AT1G07030 69.538 4.54e-156 438.0
Lacanog05199 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.891 6.85e-171 471.0
Lacanog05514 . 196 372 Chloroplast and Mitochondria gene family AT5G14040 85.876 2.14e-109 315.0
Lacanog05515 . 2 135 Chloroplast and Mitochondria gene family AT5G14040 64.179 1.88e-48 158.0
Lacanog05763 . 38 255 Chloroplast and Mitochondria gene family AT3G61470 46.154 7.26e-61 191.0
Laca1g00904 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 75.683 0.0 545.0
Laca2g00014 . 43 327 Chloroplast and Mitochondria gene family AT1G76570 78.596 1.26e-175 488.0
Laca2g01614 . 33 310 Chloroplast and Mitochondria gene family AT1G25380 28.197 7.80e-14 69.7
Laca2g01966 ACH 29 310 Chloroplast and Mitochondria gene family AT2G47490 33.016 1.27e-42 153.0
Laca2g02208 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 71.053 1.42e-116 342.0
Laca2g02414 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.161 0.0 504.0
Laca2g02415 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.161 0.0 504.0
Laca2g02459 . 2 372 Chloroplast and Mitochondria gene family AT5G14040 77.089 0.0 579.0
Laca2g03260 . 37 317 Chloroplast and Mitochondria gene family AT1G25380 25.649 1.35e-28 111.0
Laca2g03598 . 1 215 Chloroplast and Mitochondria gene family AT4G25570 70.233 3.30e-110 314.0
Laca3g00296 . 143 354 Chloroplast and Mitochondria gene family AT2G28800 22.422 7.20e-07 49.7
Laca3g00920 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 81.166 2.39e-129 364.0
Laca3g01244 . 4 580 Chloroplast and Mitochondria gene family AT4G21490 68.966 0.0 823.0
Laca3g01496 ACH 1 304 Chloroplast and Mitochondria gene family AT2G17270 67.541 2.18e-159 446.0
Laca3g01735 ACH 10 317 Chloroplast and Mitochondria gene family AT1G25380 67.949 3.15e-147 417.0
Laca3g01806 . 1 236 Chloroplast and Mitochondria gene family AT1G26100 64.49 1.34e-97 283.0
Laca3g02174 ACH 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.014 2.40e-46 157.0
Laca3g02472 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 56.579 1.31e-83 246.0
Laca4g00611 ACH 22 224 Chloroplast and Mitochondria gene family AT5G38630 44.335 4.58e-59 184.0
Laca4g00751 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.39 1.12e-172 478.0
Laca4g00752 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.39 2.64e-173 477.0
Laca4g00753 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 2.03e-172 474.0
Laca4g00754 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.46e-171 477.0
Laca4g00755 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.46e-171 477.0
Laca4g00756 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 9.43e-172 473.0
Laca4g01512 ACH 55 392 Chloroplast and Mitochondria gene family AT4G21490 40.233 9.98e-69 229.0
Laca4g02356 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 72.603 0.0 533.0
Laca4g02681 ACH 7 187 Chloroplast and Mitochondria gene family AT1G17530 59.783 1.29e-67 204.0
Laca4g02986 . 28 307 Chloroplast and Mitochondria gene family AT5G40810 87.189 2.89e-171 475.0
Laca4g03117 ACH 35 255 Chloroplast and Mitochondria gene family AT3G61470 51.584 3.80e-73 224.0
Laca4g03708 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.214 9.87e-155 431.0
Laca4g04700 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 75.478 2.90e-180 502.0
Laca5g00152 . 168 265 Chloroplast and Mitochondria gene family AT2G34430 73.737 2.34e-44 142.0
Laca5g00155 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 1.70e-122 348.0
Laca5g00159 . 40 354 Chloroplast and Mitochondria gene family AT5G54290 72.586 3.55e-147 418.0
Laca5g00273 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 72.207 0.0 538.0
Laca5g00501 ACH 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 3.20e-74 228.0
Laca5g00794 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 49.457 8.72e-51 160.0
Laca5g01846 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.679 7.32e-165 463.0
Laca5g02424 . 107 239 Chloroplast and Mitochondria gene family AT1G29910 93.985 2.89e-85 248.0
Laca5g02683 ACH 4 185 Chloroplast and Mitochondria gene family AT1G17530 62.366 1.10e-70 211.0
Laca5g03447 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.625 4.26e-151 420.0
Laca5g03820 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 27.273 2.31e-30 117.0
Laca5g03828 . 14 275 Chloroplast and Mitochondria gene family AT5G01530 83.588 1.47e-150 421.0
Laca5g04286 . 51 447 Chloroplast and Mitochondria gene family AT2G28800 75.616 0.0 602.0
Laca5g04445 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.341 1.13e-167 468.0
Laca5g04516 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 63.889 1.23e-30 109.0
Laca6g00138 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 32.857 1.04e-33 129.0
Laca7g00978 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 1.68e-173 477.0
Laca7g00979 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 1.68e-173 477.0
Laca7g00980 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 1.68e-173 477.0
Laca7g00981 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 1.16e-172 475.0
Laca7g01766 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.826 2.06e-160 451.0
Laca7g02732 . 232 279 Chloroplast and Mitochondria gene family AT1G72820 58.333 2.61e-12 60.1
Laca7g02733 . 1 150 Chloroplast and Mitochondria gene family AT1G72820 46.0 4.78e-35 121.0
Laca7g02957 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.164 7.15e-121 344.0
Laca8g00044 . 65 271 Chloroplast and Mitochondria gene family AT4G03320 35.681 2.60e-43 148.0
Laca8g00542 . 22 98 Chloroplast and Mitochondria gene family AT1G17530 54.545 6.06e-26 94.7
Laca8g00602 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 85.892 4.17e-144 401.0
Laca8g01079 . 1 223 Chloroplast and Mitochondria gene family AT1G14730 62.332 2.00e-96 279.0
Laca8g01080 ACH 14 224 Chloroplast and Mitochondria gene family AT1G14730 44.076 1.40e-60 187.0
Laca8g01246 ACH 33 363 Chloroplast and Mitochondria gene family AT1G25380 61.078 1.49e-144 412.0
Laca8g01950 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 68.116 2.42e-103 299.0
Laca8g02583 . 65 548 Chloroplast and Mitochondria gene family AT2G18710 83.264 0.0 821.0
Laca8g02680 . 33 187 Chloroplast and Mitochondria gene family AT1G17530 44.516 9.01e-27 96.7
Laca8g02960 . 1 337 Chloroplast and Mitochondria gene family AT1G72820 62.865 5.86e-143 406.0
Laca8g04280 . 49 407 Chloroplast and Mitochondria gene family AT2G28800 59.115 5.10e-155 449.0
Laca9g00032 . 1 305 Chloroplast and Mitochondria gene family AT2G47490 74.51 1.37e-159 446.0
Laca9g01064 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 85.766 3.35e-164 457.0
Laca9g01952 . 19 300 Chloroplast and Mitochondria gene family AT4G25700 65.916 1.18e-144 410.0
Laca9g02332 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 84.643 6.26e-156 436.0
Laca9g02583 . 31 116 Chloroplast and Mitochondria gene family AT1G17530 50.0 4.51e-23 89.0
Laca9g02657 . 25 96 Chloroplast and Mitochondria gene family AT1G17530 51.389 2.57e-20 80.5
Laca9g02777 . 31 98 Chloroplast and Mitochondria gene family AT1G17530 55.882 1.41e-21 85.5
Laca9g02912 . 35 95 Chloroplast and Mitochondria gene family AT3G27690 64.516 2.43e-20 81.6
Laca9g03304 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 81.752 4.10e-157 436.0
Laca9g03358 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 76.226 5.68e-146 406.0
Laca9g03360 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.057 1.11e-180 495.0
Laca9g03361 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.811 1.41e-180 499.0
Laca9g03670 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 79.845 2.66e-149 419.0