AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lomi2g04280 ATGGCTGCAGCTGCTAGCTCCACCACTGTGGTCAAAGCCACCCCATTCTTGGGTCAAACTAGATCATCTACCATCAACCCATTAAGAGATGTTGTCTCCATGCCAAGTGCCAAATTCACCATGGGAAATGACTTGTGGTATGGACCTGACCGTGTTAAGTACTTGGGACCATTTTCGGCTCAAACCCCATCTTACTTGAACGGTGAGTTCCCCGGTGATTACGGTTGGGACACTGCTGGTTTGTCTGCTGATCCTGAGGCTTTCGCTAAGAACAGGGCTCTTGAGGTTATCCACGGGCGATGGGCCATGCTTGGAGCACTCGGGTGCATCACACCCGAGGTTCTCGAAAAGTGGTTGAAAGTGGATTTCAAGGAGCCCGTTTGGTTCAAGGCCGGAGCCCAAATCTTCTCAGAAGGCGGTCTAGACTACCTAGGAAATCCGAACCTTGTCCATGCTCAGAGCATATTGGCAGTGCTCGGGTTCCAAGTGATCCTAATGGGCCTTGTAGAGGGGTTCCGTATCAACGGGCTTGATGGGGTTGGAGATGGTAACAACCTATACCCAGGTGGGCAATATTTTGACCCATTGGGCCTTGCAGATGACCCGGTGACTTTCGCTGAGTTGAAGGTGAAAGAGATCAAGAATGGAAGGCTAGCAATGTTTTCAATGTTTGGGTTTTTTGTGCAAGCAATAGTGACAGGAAAAGGCCCATTGGAGAACCTTTTGGACCATTTGGACAACCCTGTGGCTAACAATGCATGGGTCTATGCAACCAAGTTTGTGCCTGGGTCATAG 795 49.94 MAAAASSTTVVKATPFLGQTRSSTINPLRDVVSMPSAKFTMGNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWLKVDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVILMGLVEGFRINGLDGVGDGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGS 264
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Lomi2g04280 264 Gene3D Chlorophyll a-b binding protein domain 53 257 - -
Lomi2g04280 264 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 9 263 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Lomi2g04280 264 FunFam Chlorophyll a-b binding protein, chloroplastic 53 257 - -
Lomi2g04280 264 SUPERFAMILY Chlorophyll a-b binding protein 45 261 - -
Lomi2g04280 264 Pfam Chlorophyll A-B binding protein 63 231 IPR022796 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lomi2g04280 K08914 light-harvesting complex II chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Lomi Lomi-Chr1:52008027 Lomi2g04280 Lomi-Chr2:48275244 dispersed
Lomi Lomi-Chr2:48275244 Lomi5g02159 Lomi-Chr5:32155752 dispersed
Lomi Lomi-Chr1:3372705 Lomi2g04280 Lomi-Chr2:48275244 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lomi1g00268 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.281 2.16e-168 465.0
Lomi1g00377 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 66.667 1.07e-120 343.0
Lomi1g00795 LST 65 548 Chloroplast and Mitochondria gene family AT2G18710 85.331 0.0 839.0
Lomi1g01081 LST 3 139 Chloroplast and Mitochondria gene family AT1G07020 47.518 3.16e-25 92.8
Lomi1g01242 LST 51 257 Chloroplast and Mitochondria gene family AT3G61470 65.7 2.63e-100 292.0
Lomi1g02143 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 7.14e-173 476.0
Lomi1g02144 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.36e-171 472.0
Lomi1g03410 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.967 7.98e-35 132.0
Lomi1g03794 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 2.25e-174 479.0
Lomi1g03795 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 8.48e-174 478.0
Lomi1g03796 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 8.58e-172 473.0
Lomi1g03991 . 22 258 Chloroplast and Mitochondria gene family AT1G76570 73.967 2.97e-129 367.0
Lomi2g00445 . 42 327 Chloroplast and Mitochondria gene family AT1G76570 80.42 1.45e-180 500.0
Lomi2g00612 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 9.78e-174 478.0
Lomi2g00613 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 5.72e-173 476.0
Lomi2g02194 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 3.43e-169 466.0
Lomi2g02195 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 5.68e-172 473.0
Lomi2g03115 LST 51 255 Chloroplast and Mitochondria gene family AT3G61470 67.805 8.97e-102 295.0
Lomi2g03340 LST 3 139 Chloroplast and Mitochondria gene family AT1G07020 45.455 1.83e-24 90.9
Lomi2g03519 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 4.78e-34 109.0
Lomi2g03763 LST 65 548 Chloroplast and Mitochondria gene family AT2G18710 85.124 0.0 837.0
Lomi2g04280 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.041 2.88e-121 345.0
Lomi2g04387 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.281 1.91e-168 465.0
Lomi3g00427 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 72.464 1.76e-171 479.0
Lomi3g00556 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 63.587 1.22e-75 223.0
Lomi3g01005 ACH,LST 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.154 1.12e-148 414.0
Lomi3g01215 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 88.722 6.87e-169 465.0
Lomi3g01216 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 87.266 2.72e-166 459.0
Lomi3g01217 . 1 265 Chloroplast and Mitochondria gene family AT2G34420 88.015 1.18e-167 462.0
Lomi3g01218 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 86.891 3.58e-166 459.0
Lomi3g01219 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 86.891 1.07e-165 457.0
Lomi3g01220 . 1 265 Chloroplast and Mitochondria gene family AT2G34420 88.015 1.18e-167 462.0
Lomi3g01405 . 41 271 Chloroplast and Mitochondria gene family AT4G03320 37.705 1.29e-44 152.0
Lomi3g01704 LST 72 407 Chloroplast and Mitochondria gene family AT2G28800 61.625 1.40e-152 443.0
Lomi3g01972 ACH,LST 33 351 Chloroplast and Mitochondria gene family AT1G25380 62.769 2.20e-142 405.0
Lomi3g02087 ACH 5 208 Chloroplast and Mitochondria gene family AT4G25570 46.341 2.12e-60 187.0
Lomi3g02088 LST 1 223 Chloroplast and Mitochondria gene family AT1G14730 60.09 2.74e-92 268.0
Lomi3g02091 LST 1 223 Chloroplast and Mitochondria gene family AT1G14730 60.09 2.74e-92 268.0
Lomi3g02946 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 62.5 1.32e-32 105.0
Lomi3g03251 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.942 8.42e-163 452.0
Lomi4g00048 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.942 8.13e-163 452.0
Lomi4g01443 ACH,LST 1 223 Chloroplast and Mitochondria gene family AT1G14730 59.641 6.16e-92 267.0
Lomi4g01545 ACH,LST 33 351 Chloroplast and Mitochondria gene family AT1G25380 62.422 4.42e-142 405.0
Lomi4g01781 LST 72 407 Chloroplast and Mitochondria gene family AT2G28800 61.905 1.65e-151 440.0
Lomi4g02154 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 86.891 2.63e-167 461.0
Lomi4g02346 ACH,LST 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.769 4.10e-149 415.0
Lomi4g02405 . 31 135 Chloroplast and Mitochondria gene family AT1G61520 84.762 2.15e-59 182.0
Lomi4g02581 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 87.547 3.41e-179 491.0
Lomi5g00227 ACH,LST 1 366 Chloroplast and Mitochondria gene family AT5G14040 73.224 0.0 541.0
Lomi5g02134 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 89.844 8.94e-172 473.0
Lomi5g02159 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.057 0.0 497.0
Lomi5g02160 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.057 0.0 496.0
Lomi5g02381 ACH,LST 1 258 Chloroplast and Mitochondria gene family AT1G15820 79.845 3.37e-150 417.0
Lomi5g02611 ACH,LST 1 342 Chloroplast and Mitochondria gene family AT1G72820 64.535 1.62e-149 423.0
Lomi6g00089 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 32.857 4.74e-34 125.0
Lomi6g00177 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 2.53e-75 228.0
Lomi6g00277 ACH,LST 1 367 Chloroplast and Mitochondria gene family AT5G14040 70.712 0.0 542.0
Lomi6g00323 LST 5 354 Chloroplast and Mitochondria gene family AT5G54290 68.258 3.90e-149 423.0
Lomi6g01511 LST 1 305 Chloroplast and Mitochondria gene family AT2G17270 67.213 9.54e-161 448.0
Lomi6g01927 ACH,LST 144 228 Chloroplast and Mitochondria gene family AT5G14040 64.706 1.90e-30 109.0
Lomi6g02208 . 34 252 Chloroplast and Mitochondria gene family AT3G61470 90.868 6.48e-148 412.0
Lomi6g02310 . 75 354 Chloroplast and Mitochondria gene family AT2G28800 22.973 1.82e-07 51.6
Lomi6g02651 . 143 356 Chloroplast and Mitochondria gene family AT2G28800 19.556 5.03e-06 47.0
Lomi7g00283 LST 5 354 Chloroplast and Mitochondria gene family AT5G54290 67.598 2.84e-149 423.0
Lomi7g00329 ACH,LST 1 365 Chloroplast and Mitochondria gene family AT5G14040 73.151 0.0 550.0
Lomi7g00425 . 41 255 Chloroplast and Mitochondria gene family AT3G61470 52.093 2.60e-74 225.0
Lomi7g01331 LST 1 305 Chloroplast and Mitochondria gene family AT2G17270 67.213 8.90e-163 453.0
Lomi7g01574 ACH 10 318 Chloroplast and Mitochondria gene family AT1G25380 66.667 1.03e-142 405.0
Lomi7g01629 . 10 236 Chloroplast and Mitochondria gene family AT1G26100 66.102 1.15e-92 270.0
Lomi7g01697 ACH,LST 2 373 Chloroplast and Mitochondria gene family AT5G14040 77.419 0.0 580.0
Lomi7g01950 . 34 254 Chloroplast and Mitochondria gene family AT3G61470 90.498 1.35e-148 414.0
Lomi8g00080 LST 1 215 Chloroplast and Mitochondria gene family AT4G25570 68.837 2.80e-110 315.0
Lomi8g00299 . 33 304 Chloroplast and Mitochondria gene family AT2G47490 29.276 1.57e-28 110.0
Lomi8g00470 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 81.667 3.00e-140 391.0
Lomi8g00856 ACH,LST 2 369 Chloroplast and Mitochondria gene family AT5G14040 78.261 0.0 577.0
Lomi8g01096 LST 33 308 Chloroplast and Mitochondria gene family AT1G25380 36.491 6.48e-47 160.0
Lomi8g01150 . 6 303 Chloroplast and Mitochondria gene family AT2G17270 66.107 5.53e-150 421.0
Lomi8g01239 LST 33 313 Chloroplast and Mitochondria gene family AT1G25380 28.617 1.64e-14 71.6
Lomi9g00072 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.33 1.18e-169 474.0
Lomi9g00292 ACH,LST 5 367 Chloroplast and Mitochondria gene family AT5G14040 71.154 0.0 518.0
Lomi9g00480 . 35 255 Chloroplast and Mitochondria gene family AT3G61470 52.489 5.65e-75 226.0
Lomi9g00602 . 51 251 Chloroplast and Mitochondria gene family AT3G61470 49.51 5.07e-61 192.0
Lomi9g01151 ACH,LST 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.129 0.0 513.0
Lomi9g01322 LST 11 322 Chloroplast and Mitochondria gene family AT5G15640 67.949 1.61e-165 461.0
Lomi9g01323 LST 11 320 Chloroplast and Mitochondria gene family AT5G15640 77.742 0.0 508.0
Lomi9g01929 LST 19 300 Chloroplast and Mitochondria gene family AT4G25700 65.584 1.17e-144 408.0
Lomi10g00081 LST 1 215 Chloroplast and Mitochondria gene family AT4G25570 67.907 1.79e-108 310.0
Lomi10g00358 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.917 1.26e-141 395.0
Lomi10g00781 ACH,LST 2 369 Chloroplast and Mitochondria gene family AT5G14040 79.348 0.0 577.0
Lomi10g00811 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.129 0.0 509.0
Lomi10g00969 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 71.491 1.19e-119 338.0
Lomi10g01150 LST 33 308 Chloroplast and Mitochondria gene family AT1G25380 36.842 1.08e-46 159.0
Lomi10g01703 ACH 4 215 Chloroplast and Mitochondria gene family AT4G25570 42.453 5.15e-57 179.0
Lomi10g01809 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.09e-171 473.0
Lomi11g00187 ACH,LST 1 367 Chloroplast and Mitochondria gene family AT5G14040 73.842 0.0 543.0
Lomi11g01972 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.434 0.0 496.0
Lomi11g02170 ACH,LST 1 258 Chloroplast and Mitochondria gene family AT1G15820 79.845 9.02e-149 414.0
Lomi11g02379 ACH,LST 1 343 Chloroplast and Mitochondria gene family AT1G72820 64.928 1.40e-149 423.0
Lomi12g00421 LST 19 300 Chloroplast and Mitochondria gene family AT4G25700 66.234 5.57e-144 406.0
Lomi12g00843 LST 11 320 Chloroplast and Mitochondria gene family AT5G15640 77.419 0.0 507.0
Lomi12g00844 LST 10 320 Chloroplast and Mitochondria gene family AT5G15640 69.775 1.32e-169 472.0
Lomi12g01061 ACH,LST 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.129 0.0 513.0
Lomi12g01479 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 85.053 2.46e-158 440.0
Lomi12g01480 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.986 3.05e-155 432.0
Lomi12g01482 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 85.053 1.35e-157 439.0
Lomi12g01573 . 34 254 Chloroplast and Mitochondria gene family AT3G61470 46.429 1.21e-61 193.0
Lomi12g01781 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 57.214 6.76e-76 229.0
Lomi12g02014 ACH,LST 54 367 Chloroplast and Mitochondria gene family AT5G14040 78.095 0.0 518.0
Lomi13g00266 LST 34 450 Chloroplast and Mitochondria gene family AT2G28800 75.294 0.0 621.0
Lomi13g00370 LST 1 327 Chloroplast and Mitochondria gene family AT2G30160 70.427 1.58e-167 468.0
Lomi13g00432 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 3.36e-34 109.0
Lomi13g00710 LST 8 307 Chloroplast and Mitochondria gene family AT2G47490 78.405 2.84e-166 463.0
Lomi13g00724 LST 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.168 1.28e-31 120.0
Lomi14g00520 LST 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.168 1.44e-29 115.0
Lomi14g00535 LST 8 307 Chloroplast and Mitochondria gene family AT2G47490 80.0 2.39e-169 471.0
Lomi14g00840 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 3.36e-34 109.0
Lomi14g00872 LST 1 266 Chloroplast and Mitochondria gene family AT2G30160 69.663 1.42e-127 363.0
Lomi14g00979 LST 34 450 Chloroplast and Mitochondria gene family AT2G28800 75.059 0.0 623.0