AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lssa7g03224 ATGAAACTAGACCAAGAACTCAACCAACACGGCCGTGACATCATCAGAACCATCGAAGTAGTTCAATCTGTCACCAAGCTATCAACCACCGCCGTTGATAACTTCGATTCAAATGGGGAAGAGCTCTACACGCCTCCGCTTAATTTCTCCATGGTTGATAATGGCATATTCCGTTCAGGATTCCCCGATACCGCTAACTTCTCGTTTCTCAAAACCCTAGGCCTTCGCTCCATCGTATATTTGTGTCCTGAACCGTATCCGGAGCATAACATGGAATTTCTGAAGGCTAATCGGATCCAATTGTTTCAATTCGGAATCGAAGGCACCAAGGAACCTTTCGTTAATATCCCAGAGGACACAATTCGTGAAGCATTAAAAGTTGTTCTAGATGTAAGAAATCACCCATTGTTGATCCATTGCAAAAGAGGCAAGCATCGAACGGGTTGTTTAGTGGGATGCTTGAGAAAAATACAGAGATGGTGTTTGACATCTATTTTTGATGAGTATCAAAGGTTTGCAGCTGCTAAAGCTAGGGTTTCAGATCAGAGGTTTATGGAGTTGTTTGATGCCTCTGGGTTTAAGGATATTCCACCATCTCCATGTTCATGTACCAAAAGAAGGTGA 624 42.95 MKLDQELNQHGRDIIRTIEVVQSVTKLSTTAVDNFDSNGEELYTPPLNFSMVDNGIFRSGFPDTANFSFLKTLGLRSIVYLCPEPYPEHNMEFLKANRIQLFQFGIEGTKEPFVNIPEDTIREALKVVLDVRNHPLLIHCKRGKHRTGCLVGCLRKIQRWCLTSIFDEYQRFAAAKARVSDQRFMELFDASGFKDIPPSPCSCTKRR 207
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Lssa7g03224 207 SUPERFAMILY (Phosphotyrosine protein) phosphatases II 43 189 IPR029021 -
Lssa7g03224 207 ProSiteProfiles Dual specificity protein phosphatase domain profile. 48 199 IPR020422 GO:0006470(InterPro)
Lssa7g03224 207 Pfam Tyrosine phosphatase family 45 195 IPR004861 -
Lssa7g03224 207 CDD PFA-DSP-Siw14 42 189 - -
Lssa7g03224 207 PANTHER TYROSINE-PROTEIN PHOSPHATASE 38 198 - GO:0005737(PANTHER)|GO:0016791(PANTHER)
Lssa7g03224 207 FunFam probable tyrosine-protein phosphatase At1g05000 42 192 - -
Lssa7g03224 207 PRINTS Plant and fungal dual specificity phosphatase signature 116 130 IPR020428 GO:0016791(InterPro)
Lssa7g03224 207 PRINTS Plant and fungal dual specificity phosphatase signature 99 113 IPR020428 GO:0016791(InterPro)
Lssa7g03224 207 PRINTS Plant and fungal dual specificity phosphatase signature 43 60 IPR020428 GO:0016791(InterPro)
Lssa7g03224 207 PRINTS Plant and fungal dual specificity phosphatase signature 80 93 IPR020428 GO:0016791(InterPro)
Lssa7g03224 207 Gene3D Protein tyrosine phosphatase superfamily 43 192 IPR029021 -
Lssa7g03224 207 ProSitePatterns Tyrosine specific protein phosphatases active site. 138 148 IPR016130 GO:0016311(InterPro)
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lssa7g03224 K18045 tyrosine-protein phosphatase SIW14 [EC:3.1.3.48]
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Lssa Lssa-Chr2:41521816 Lssa7g03224 Lssa-Chr7:171526821 transposed
Lssa Lssa-Chr9:62535270 Lssa7g03224 Lssa-Chr7:171526821 transposed
Lssa Lssa-Chr7:18641978 Lssa7g03224 Lssa-Chr7:171526821 wgd
Lssa Lssa-Chr7:171526821 Lssa9g03851 Lssa-Chr9:193971008 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lssa9g01885 . 12 191 Protein tyrosine phosphatase (PTP) family AT3G02800 63.889 1.05e-86 253.0
Lssa9g03851 . 12 204 Protein tyrosine phosphatase (PTP) family AT1G05000 67.358 9.79e-91 263.0
Lssa9g00245 . 1 653 Protein tyrosine phosphatase (PTP) family AT5G01290 55.208 0.0 704.0
Lssa9g04420 . 408 563 Protein tyrosine phosphatase (PTP) family AT3G01510 66.456 6.95e-74 229.0
Lssa9g02709 . 1 374 Protein tyrosine phosphatase (PTP) family AT3G52180 61.17 1.30e-159 451.0
Lssa9g04149 . 901 960 Protein tyrosine phosphatase (PTP) family AT5G58160 59.677 2.80e-16 73.2
Lssa9g04019 . 27 611 Protein tyrosine phosphatase (PTP) family AT3G19420 68.297 0.0 805.0
Lssa8g00686 . 1 784 Protein tyrosine phosphatase (PTP) family AT3G55270 50.976 0.0 729.0
Lssa8g03546 . 1 653 Protein tyrosine phosphatase (PTP) family AT5G01290 60.432 0.0 790.0
Lssa8g02020 . 457 536 Protein tyrosine phosphatase (PTP) family AT3G01510 36.25 1.22e-06 48.9
Lssa8g02994 . 681 722 Protein tyrosine phosphatase (PTP) family AT5G23720 71.429 4.28e-12 65.1
Lssa8g04916 . 1053 1195 Protein tyrosine phosphatase (PTP) family AT5G58160 51.748 2.84e-38 136.0
Lssa8g02318 . 1 373 Protein tyrosine phosphatase (PTP) family AT5G58160 53.476 4.80e-135 435.0
Lssa8g03156 . 34 227 Protein tyrosine phosphatase (PTP) family AT5G56610 72.821 1.02e-102 297.0
Lssa8g03614 . 408 563 Protein tyrosine phosphatase (PTP) family AT3G01510 66.456 6.95e-74 229.0
Lssa7g03081 . 39 399 Protein tyrosine phosphatase (PTP) family AT5G39400 53.804 2.19e-133 385.0
Lssa7g01449 . 34 227 Protein tyrosine phosphatase (PTP) family AT5G56610 72.68 3.19e-102 296.0
Lssa7g00517 . 47 203 Protein tyrosine phosphatase (PTP) family AT1G05000 56.831 2.02e-69 209.0
Lssa7g03224 . 20 215 Protein tyrosine phosphatase (PTP) family AT1G05000 73.096 1.77e-101 290.0
Lssa7g01774 . 1 375 Protein tyrosine phosphatase (PTP) family AT5G58160 65.426 3.82e-179 560.0
Lssa6g02291 . 16 303 Protein tyrosine phosphatase (PTP) family AT2G35320 56.122 2.91e-122 350.0
Lssa6g01848 . 66 159 Protein tyrosine phosphatase (PTP) family AT3G01510 29.787 1.86e-08 53.9
Lssa6g03432 . 891 963 Protein tyrosine phosphatase (PTP) family AT5G58160 52.055 7.63e-16 68.9
Lssa6g02680 . 59 112 Protein tyrosine phosphatase (PTP) family AT3G10550 61.111 4.70e-14 65.1
Lssa6g00660 . 399 566 Protein tyrosine phosphatase (PTP) family AT3G01510 60.714 9.17e-66 213.0
Lssa6g03108 . 657 722 Protein tyrosine phosphatase (PTP) family AT5G23720 71.212 1.42e-25 102.0
Lssa6g03421 . 136 163 Protein tyrosine phosphatase (PTP) family AT3G09100 78.571 1.55e-08 49.7
Lssa6g02501 . 136 163 Protein tyrosine phosphatase (PTP) family AT3G09100 78.571 1.65e-08 49.7
Lssa5g01579 . 265 337 Protein tyrosine phosphatase (PTP) family AT3G52180 38.667 4.64e-07 50.1
Lssa5g02217 . 148 313 Protein tyrosine phosphatase (PTP) family AT3G19420 82.353 1.32e-97 301.0
Lssa5g02834 ACH 1 398 Protein tyrosine phosphatase (PTP) family AT5G58160 69.0 0.0 617.0
Lssa5g05431 . 408 563 Protein tyrosine phosphatase (PTP) family AT3G01510 65.823 3.47e-73 228.0
Lssa5g02391 . 20 190 Protein tyrosine phosphatase (PTP) family AT3G23610 62.573 3.31e-77 227.0
Lssa5g04962 . 49 186 Protein tyrosine phosphatase (PTP) family AT3G23610 34.483 2.57e-18 80.5
Lssa5g04943 . 36 339 Protein tyrosine phosphatase (PTP) family AT1G71860 54.572 3.03e-118 344.0
Lssa5g03818 . 1 257 Protein tyrosine phosphatase (PTP) family AT2G04550 62.182 1.16e-109 315.0
Lssa4g04169 . 408 563 Protein tyrosine phosphatase (PTP) family AT3G01510 66.456 6.95e-74 229.0
Lssa4g02215 . 451 534 Protein tyrosine phosphatase (PTP) family AT3G01510 35.714 5.31e-07 48.9
Lssa4g02933 . 40 271 Protein tyrosine phosphatase (PTP) family AT5G23720 70.339 2.98e-110 337.0
Lssa3g02967 . 59 611 Protein tyrosine phosphatase (PTP) family AT3G19420 62.59 0.0 708.0
Lssa3g03234 . 36 395 Protein tyrosine phosphatase (PTP) family AT5G39400 51.389 1.82e-118 347.0
Lssa3g03226 . 39 396 Protein tyrosine phosphatase (PTP) family AT5G39400 51.801 4.72e-128 371.0
Lssa3g04479 . 1 321 Protein tyrosine phosphatase (PTP) family AT2G35680 54.206 3.76e-113 328.0
Lssa3g00026 . 1 325 Protein tyrosine phosphatase (PTP) family AT2G35680 53.593 1.58e-114 333.0
Lssa3g03168 . 136 163 Protein tyrosine phosphatase (PTP) family AT3G09100 78.571 1.65e-08 49.7
Lssa3g04455 . 902 960 Protein tyrosine phosphatase (PTP) family AT5G58160 62.295 2.23e-15 75.1
Lssa3g04108 . 136 166 Protein tyrosine phosphatase (PTP) family AT3G09100 70.968 2.16e-09 50.8
Lssa3g04086 . 136 163 Protein tyrosine phosphatase (PTP) family AT3G09100 75.0 5.94e-08 46.6
Lssa3g03229 . 39 396 Protein tyrosine phosphatase (PTP) family AT5G39400 49.307 3.36e-113 333.0
Lssa3g03222 . 1 395 Protein tyrosine phosphatase (PTP) family AT5G39400 57.789 1.15e-165 469.0
Lssa3g02646 . 136 163 Protein tyrosine phosphatase (PTP) family AT3G09100 78.571 2.73e-08 49.7
Lssa3g01026 . 48 190 Protein tyrosine phosphatase (PTP) family AT3G23610 34.722 3.95e-23 95.9
Lssa2g03324 . 1 372 Protein tyrosine phosphatase (PTP) family AT3G52180 58.14 8.34e-148 421.0
Lssa2g03335 . 63 840 Protein tyrosine phosphatase (PTP) family AT3G10550 63.022 0.0 1023.0
Lssa2g04099 . 30 282 Protein tyrosine phosphatase (PTP) family AT3G10940 70.221 1.09e-138 392.0
Lssa2g02934 . 62 590 Protein tyrosine phosphatase (PTP) family AT3G01510 72.505 0.0 803.0
Lssa2g00589 . 17 191 Protein tyrosine phosphatase (PTP) family AT3G02800 66.857 5.15e-87 254.0
Lssa1g01162 ACH 459 536 Protein tyrosine phosphatase (PTP) family AT3G01510 35.443 4.83e-06 47.0
Lssa1g02050 . 408 563 Protein tyrosine phosphatase (PTP) family AT3G01510 65.19 2.23e-72 226.0
Lssa1g02229 . 18 239 Protein tyrosine phosphatase (PTP) family AT3G44620 63.362 8.24e-96 278.0