AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Lssa7g03403 ATGGCTACACAGGCTTTGGTCTCATCGTCTTCGCTCACCTCCTCCGTGGAGTCTGCTAGGCAAATCCTAGCAGCCAGGCCACTTCACACAACATCTTCAAGAAAGGTCTCCTTTGTTGTCAAAGCTGCTTCCACCCCTCCTGTTAAGCAAGGAGCTAACAGACAGTTGTGGTTTGCATCCAAGCAATCTCTCTCTTACCTTGATGGAAGTCTCCCAGGCGACTTTGGGTTCGACCCACTTGGTCTCTCGGACCCAGAAGGAACCGGAGGATTCATCGAACCCAAGTGGCTAGCATACGGCGAGGTTATCAATGGACGTTTCGCCATGTTGGGTGCAGCTGGCGCCATTGCACCAGAGATCTTCGGCAAGCTTGGGCTCATCCCACCGGAAACCGCCCTCCCTTGGTTCAAGACCGGTGTCATTCCCCCAGCCGGAACATACAACTACTGGGCAGACCCTTTCACCCTATTTGTATTGGAAATGGCGTTGATGGGTTTCGCAGAGCATAGAAGACTCCAAGACTGGTATAACCCAGGGTCAATGGGGAAGCAATACTTCTTGGGGTTGGAGAAAGGTTTTTCAGGGTCGGGTGACCCGGCATACCCAGGTGGGCCGTTCTTTAACCCACTCGGGTTCGGGAAAGATGAGAAGTCAATGAAGGAACTGAAGCTAAAAGAAATCAAGAATGGAAGATTGGCTATGTTAGCAATCTTGGGTTACTTCATTCAGGGTTTGGTGACCGGGGTTGGACCTTTCGAGAACCTGCTGGACCATTTGGCTGATCCTGTCAACAACAATGTCTTGACTAGCCTCAAGTTCCACTAG 825 51.27 MATQALVSSSSLTSSVESARQILAARPLHTTSSRKVSFVVKAASTPPVKQGANRQLWFASKQSLSYLDGSLPGDFGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEIFGKLGLIPPETALPWFKTGVIPPAGTYNYWADPFTLFVLEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQGLVTGVGPFENLLDHLADPVNNNVLTSLKFH 274
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Lssa7g03403 274 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 9 269 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Lssa7g03403 274 Pfam Chlorophyll A-B binding protein 65 244 IPR022796 -
Lssa7g03403 274 FunFam Chlorophyll a-b binding protein, chloroplastic 55 273 - -
Lssa7g03403 274 Gene3D Chlorophyll a-b binding protein domain 55 273 - -
Lssa7g03403 274 SUPERFAMILY Chlorophyll a-b binding protein 53 270 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Lssa7g03403 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Lssa Lssa-Chr7:179187809 Lssa9g03739 Lssa-Chr9:187338404 dispersed
Lssa Lssa-Chr7:179187809 Lssa9g02625 Lssa-Chr9:99371631 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Lssa9g03805 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.811 0.0 496.0
Lssa9g04211 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.233 2.08e-149 416.0
Lssa9g01259 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 85.766 3.42e-164 457.0
Lssa9g00052 . 1 312 Chloroplast and Mitochondria gene family AT2G47490 70.288 8.59e-148 416.0
Lssa9g03804 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.811 0.0 496.0
Lssa9g02625 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 84.643 3.66e-156 436.0
Lssa9g03803 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.811 0.0 495.0
Lssa9g02218 . 19 300 Chloroplast and Mitochondria gene family AT4G25700 65.595 3.78e-144 409.0
Lssa9g00637 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 73.611 1.30e-36 116.0
Lssa9g03739 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 63.385 1.99e-131 373.0
Lssa8g03918 . 1 320 Chloroplast and Mitochondria gene family AT1G07030 69.231 5.24e-156 438.0
Lssa8g01323 . 14 224 Chloroplast and Mitochondria gene family AT1G14730 44.55 4.50e-61 189.0
Lssa8g01322 ACH 1 223 Chloroplast and Mitochondria gene family AT1G14730 61.435 6.92e-95 275.0
Lssa8g02041 . 5 157 Chloroplast and Mitochondria gene family AT1G17530 58.599 7.20e-61 185.0
Lssa8g05216 . 42 407 Chloroplast and Mitochondria gene family AT2G28800 58.333 1.47e-155 450.0
Lssa8g00757 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 86.307 6.06e-145 403.0
Lssa8g00080 . 69 271 Chloroplast and Mitochondria gene family AT4G03320 34.928 8.17e-42 144.0
Lssa8g03539 . 1 337 Chloroplast and Mitochondria gene family AT1G72820 64.412 5.05e-144 410.0
Lssa8g01505 ACH 33 363 Chloroplast and Mitochondria gene family AT1G25380 60.778 1.65e-143 409.0
Lssa8g03085 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 68.599 9.45e-104 300.0
Lssa8g03773 . 93 263 Chloroplast and Mitochondria gene family AT1G72820 35.393 1.17e-12 67.0
Lssa8g03920 . 3 143 Chloroplast and Mitochondria gene family AT1G07020 47.586 5.10e-29 102.0
Lssa8g02405 . 65 548 Chloroplast and Mitochondria gene family AT2G18710 83.471 0.0 824.0
Lssa7g01266 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 4.04e-173 476.0
Lssa7g03403 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.891 6.85e-171 471.0
Lssa7g01264 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 4.04e-173 476.0
Lssa7g03631 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.164 9.10e-121 343.0
Lssa7g02609 . 97 188 Chloroplast and Mitochondria gene family AT1G72750 52.174 3.08e-16 68.2
Lssa7g01268 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 4.04e-173 476.0
Lssa7g02121 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.536 1.20e-159 449.0
Lssa7g01271 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 4.04e-173 476.0
Lssa7g01262 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.52e-172 475.0
Lssa7g01263 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.52e-172 475.0
Lssa7g01267 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 4.04e-173 476.0
Lssa7g01265 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 4.04e-173 476.0
Lssa6g03377 . 41 324 Chloroplast and Mitochondria gene family AT1G07030 33.101 2.10e-34 126.0
Lssa6g00238 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 32.857 1.29e-33 129.0
Lssa5g04192 ACH 4 187 Chloroplast and Mitochondria gene family AT1G17530 63.043 1.23e-73 218.0
Lssa5g01264 . 101 188 Chloroplast and Mitochondria gene family AT1G72750 48.864 5.94e-16 67.0
Lssa5g04557 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 1.21e-172 475.0
Lssa5g00343 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 72.48 0.0 540.0
Lssa5g03359 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.625 4.26e-151 420.0
Lssa5g04821 ACH 37 306 Chloroplast and Mitochondria gene family AT1G25380 27.187 5.15e-30 116.0
Lssa5g02454 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.971 1.44e-167 470.0
Lssa5g04555 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 1.21e-172 475.0
Lssa5g05516 ACH 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.341 1.13e-167 468.0
Lssa5g00627 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 3.56e-74 228.0
Lssa5g01856 . 13 132 Chloroplast and Mitochondria gene family AT5G38630 40.0 2.36e-29 106.0
Lssa5g00226 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 5.47e-122 347.0
Lssa5g00228 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 5.47e-122 347.0
Lssa5g04556 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 1.21e-172 475.0
Lssa5g04834 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 85.036 1.68e-162 451.0
Lssa5g00232 . 40 354 Chloroplast and Mitochondria gene family AT5G54290 72.586 4.99e-147 418.0
Lssa5g05335 . 51 447 Chloroplast and Mitochondria gene family AT2G28800 75.616 0.0 602.0
Lssa4g03295 ACH 7 187 Chloroplast and Mitochondria gene family AT1G17530 61.413 6.71e-71 211.0
Lssa4g01032 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 6.36e-173 476.0
Lssa4g00822 ACH 8 224 Chloroplast and Mitochondria gene family AT5G38630 38.397 7.41e-48 156.0
Lssa4g01029 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 1.60e-173 477.0
Lssa4g03638 . 5 307 Chloroplast and Mitochondria gene family AT5G40810 83.224 6.90e-174 482.0
Lssa4g02927 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 72.877 0.0 533.0
Lssa4g03284 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 69.122 1.48e-172 482.0
Lssa4g01948 . 55 393 Chloroplast and Mitochondria gene family AT4G21490 40.116 8.25e-69 230.0
Lssa4g01030 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 1.60e-173 477.0
Lssa4g05805 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 75.796 0.0 504.0
Lssa4g01033 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 1.61e-173 477.0
Lssa4g04543 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 83.214 9.87e-155 431.0
Lssa3g01722 ACH 1 304 Chloroplast and Mitochondria gene family AT2G17270 67.869 4.81e-160 447.0
Lssa3g02103 . 1 229 Chloroplast and Mitochondria gene family AT1G26100 60.924 8.82e-89 261.0
Lssa3g01449 . 4 580 Chloroplast and Mitochondria gene family AT4G21490 66.833 0.0 814.0
Lssa3g00534 . 5 187 Chloroplast and Mitochondria gene family AT1G17530 61.497 1.98e-68 205.0
Lssa3g02039 ACH 10 317 Chloroplast and Mitochondria gene family AT1G25380 67.628 8.56e-146 413.0
Lssa3g03112 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 62.719 6.45e-100 288.0
Lssa3g01065 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 90.583 1.99e-151 421.0
Lssa3g02105 . 1 235 Chloroplast and Mitochondria gene family AT1G26100 63.934 2.53e-95 277.0
Lssa3g03663 ACH 2 372 Chloroplast and Mitochondria gene family AT5G14040 78.167 0.0 584.0
Lssa3g02607 ACH 29 300 Chloroplast and Mitochondria gene family AT2G47490 35.664 4.31e-46 156.0
Lssa2g03001 . 10 305 Chloroplast and Mitochondria gene family AT5G40810 84.95 4.43e-175 486.0
Lssa2g03045 ACH 2 372 Chloroplast and Mitochondria gene family AT5G14040 77.628 0.0 581.0
Lssa2g03003 . 20 307 Chloroplast and Mitochondria gene family AT5G40810 87.285 1.72e-177 490.0
Lssa2g02440 ACH 29 310 Chloroplast and Mitochondria gene family AT2G47490 33.333 2.85e-45 155.0
Lssa2g04369 . 1 215 Chloroplast and Mitochondria gene family AT4G25570 70.37 5.35e-109 311.0
Lssa2g02761 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 70.614 3.64e-118 334.0
Lssa2g02059 . 33 310 Chloroplast and Mitochondria gene family AT1G25380 28.197 7.80e-14 69.7
Lssa2g00030 . 43 327 Chloroplast and Mitochondria gene family AT1G76570 78.596 1.91e-175 487.0
Lssa2g03981 . 37 338 Chloroplast and Mitochondria gene family AT1G25380 22.985 5.96e-20 89.4
Lssa2g03330 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.05e-172 475.0
Lssa2g03002 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.484 0.0 508.0
Lssa1g02133 . 6 187 Chloroplast and Mitochondria gene family AT1G17530 51.351 4.24e-57 176.0
Lssa1g01140 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 75.41 0.0 546.0
Lssa1g03393 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 2.20e-169 467.0