AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Mimi17g02103 ATGACAGGGGAGAATTCGCCACAAAAATACCTTGTGCTGAAAAAGGCATCATGTCAAGGAACTTGTTCAGAATCAGCCATGGACAGAAGCTCAAAGCAGCTAAAGAAGGAGTATCAAGTGTATGTGAACCACTTCCTGCTGACAGACCAATATGGTTCCCAGGATCCTCACCTCCCGAATGGCTCGATGGCAGGATCTGATCCAGAATTACTCAAATGGTTTGCTCAAGCTGAGTTGATGCACAGCAGATGGGCAATGCTTGCAGTTGCTGGTATTCTGATCCCCGAATGGCTCGAAAGTTTGGGCTTTATCGACAACTTCTCGTGGTTTGAAGCGGGCTCTAGAGAATACTTTGCTGACCCGACCACTTTGTTTGTGGTGCAATTGGCCTTGATGGGTTGGGTGGAGGGTCGAAGATGGGCTGACATGATCAACCCAGGATGTGTTGACATCGAGCCTACTCTGCCCAATAAGAAGAAACCAAAGCCAGATGTCGGGTACCCGGGTGGATTGTGGTTCGACCCGTTCATGTGGGGAAGAGGGTCTCCAGAACCGGTGATGGTTTTGAGGACCAAAGAGATAAAGAACGGGCGGCTAGCCATGCTGGCTTTTACGGGTTTTGTATTCCAAGCCATTTACACCGGTCAAGGCCCTCTTGAGAATCTATCGGCTCACCTTGCGGACCCTGGTCATGTCAATATCTTCTCGGTAACCACCTTTGGTTCACTTTTCTCACTTTAG 741 49.12 MTGENSPQKYLVLKKASCQGTCSESAMDRSSKQLKKEYQVYVNHFLLTDQYGSQDPHLPNGSMAGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWLESLGFIDNFSWFEAGSREYFADPTTLFVVQLALMGWVEGRRWADMINPGCVDIEPTLPNKKKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFTGFVFQAIYTGQGPLENLSAHLADPGHVNIFSVTTFGSLFSL 246
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Mimi17g02103 246 Pfam Chlorophyll A-B binding protein 65 212 IPR022796 -
Mimi17g02103 246 SUPERFAMILY Chlorophyll a-b binding protein 50 238 - -
Mimi17g02103 246 Gene3D Chlorophyll a-b binding protein domain 49 231 - -
Mimi17g02103 246 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 65 239 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Mimi17g02103 K08908 light-harvesting complex I chlorophyll a/b binding protein 2
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Mimi Mimi-Chr17:78202878 Mimi9g00445 Mimi-Chr9:7880813 dispersed
Mimi Mimi-Chr17:78202878 Mimi15g01949 Mimi-Chr15:87386560 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Mimi19g00534 . 41 296 Chloroplast and Mitochondria gene family AT1G07030 29.845 1.24e-24 99.4
Mimi19g00833 . 33 338 Chloroplast and Mitochondria gene family AT1G25380 62.783 2.29e-133 395.0
Mimi19g01256 . 49 343 Chloroplast and Mitochondria gene family AT1G72820 67.677 1.26e-134 383.0
Mimi19g01319 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 59.239 1.58e-67 202.0
Mimi19g01418 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.696 6.79e-163 459.0
Mimi18g00082 . 76 407 Chloroplast and Mitochondria gene family AT2G28800 63.842 1.90e-155 450.0
Mimi18g00543 . 24 224 Chloroplast and Mitochondria gene family AT1G14730 63.682 3.65e-88 257.0
Mimi18g00988 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 83.75 1.39e-145 405.0
Mimi18g01888 . 141 271 Chloroplast and Mitochondria gene family AT4G03320 38.931 8.55e-28 102.0
Mimi18g02280 . 26 270 Chloroplast and Mitochondria gene family AT5G40810 86.29 3.12e-149 432.0
Mimi17g00010 . 43 548 Chloroplast and Mitochondria gene family AT2G18710 79.727 0.0 814.0
Mimi17g00380 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.5 2.33e-165 457.0
Mimi17g01195 . 11 123 Chloroplast and Mitochondria gene family AT1G07020 38.793 1.71e-09 51.2
Mimi17g01228 . 11 113 Chloroplast and Mitochondria gene family AT1G07020 41.593 2.42e-08 49.3
Mimi17g01351 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 60.807 1.70e-140 399.0
Mimi17g01434 . 1 61 Chloroplast and Mitochondria gene family AT5G05370 66.667 1.13e-24 91.3
Mimi17g01441 . 1 71 Chloroplast and Mitochondria gene family AT5G05370 69.014 4.07e-34 109.0
Mimi17g01714 . 70 548 Chloroplast and Mitochondria gene family AT2G18710 83.716 0.0 811.0
Mimi17g02103 . 58 255 Chloroplast and Mitochondria gene family AT3G61470 58.586 6.66e-78 234.0
Mimi17g02688 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.194 7.46e-169 465.0
Mimi17g02689 ACH,WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 1.94e-169 467.0
Mimi16g00428 WGDA 1 263 Chloroplast and Mitochondria gene family AT2G30160 69.057 1.19e-121 348.0
Mimi16g02079 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.398 3.63e-30 116.0
Mimi16g02089 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 75.0 1.60e-160 448.0
Mimi16g02403 WGDA 1 327 Chloroplast and Mitochondria gene family AT2G30160 70.427 1.15e-164 460.0
Mimi16g02487 . 51 449 Chloroplast and Mitochondria gene family AT2G28800 77.114 0.0 597.0
Mimi15g01048 ACH 49 228 Chloroplast and Mitochondria gene family AT5G38630 65.0 3.49e-85 251.0
Mimi15g01538 . 143 354 Chloroplast and Mitochondria gene family AT2G28800 19.731 5.95e-06 46.6
Mimi15g01949 . 45 254 Chloroplast and Mitochondria gene family AT3G61470 92.381 4.04e-147 410.0
Mimi14g01429 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.233 2.87e-147 410.0
Mimi13g00859 . 24 325 Chloroplast and Mitochondria gene family AT1G76570 74.839 1.44e-175 487.0
Mimi13g00882 . 24 325 Chloroplast and Mitochondria gene family AT1G76570 67.868 4.19e-164 459.0
Mimi13g01190 . 55 254 Chloroplast and Mitochondria gene family AT3G61470 50.943 3.75e-67 207.0
Mimi13g01192 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 2.76e-75 227.0
Mimi13g01852 . 192 318 Chloroplast and Mitochondria gene family AT5G54290 85.039 9.51e-73 223.0
Mimi11g00697 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 82.857 9.36e-155 431.0
Mimi11g01050 . 53 255 Chloroplast and Mitochondria gene family AT3G61470 52.217 1.82e-67 206.0
Mimi11g01270 . 62 361 Chloroplast and Mitochondria gene family AT5G14040 79.333 3.25e-180 502.0
Mimi11g01506 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 70.231 7.40e-177 492.0
Mimi11g01510 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 70.231 9.22e-177 492.0
Mimi10g01142 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.567 1.24e-170 470.0
Mimi10g01267 . 4 154 Chloroplast and Mitochondria gene family AT4G25570 45.752 2.11e-32 123.0
Mimi9g00445 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.09 1.46e-148 414.0
Mimi8g00144 . 31 318 Chloroplast and Mitochondria gene family AT1G07030 30.612 6.01e-36 130.0
Mimi8g00246 . 2 263 Chloroplast and Mitochondria gene family AT2G05100 67.17 2.58e-120 344.0
Mimi6g00645 WGDA 29 296 Chloroplast and Mitochondria gene family AT2G47490 35.563 4.53e-42 145.0
Mimi6g01904 . 33 294 Chloroplast and Mitochondria gene family AT2G47490 25.17 5.46e-16 75.9
Mimi5g00189 . 1 356 Chloroplast and Mitochondria gene family AT5G14040 74.23 0.0 531.0
Mimi5g00944 . 1 346 Chloroplast and Mitochondria gene family AT1G72820 60.807 1.98e-140 399.0
Mimi4g01144 . 60 128 Chloroplast and Mitochondria gene family AT1G61520 52.703 2.17e-14 65.9
Mimi4g01176 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 1.51e-178 490.0
Mimi4g01177 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.434 0.0 496.0
Mimi4g01505 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 66.57 1.32e-154 436.0
Mimi3g01052 ACH 1 210 Chloroplast and Mitochondria gene family AT1G15820 79.524 5.28e-117 332.0
Mimi3g01284 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 1.90e-167 462.0
Mimi3g01285 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 3.08e-168 464.0
Mimi3g01286 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 9.54e-168 462.0
Mimi3g01287 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 3.08e-168 464.0
Mimi3g01550 . 7 284 Chloroplast and Mitochondria gene family AT5G15640 55.036 6.82e-103 304.0
Mimi3g01713 . 42 307 Chloroplast and Mitochondria gene family AT3G27240 92.481 2.73e-173 478.0
Mimi3g02090 . 1 300 Chloroplast and Mitochondria gene family AT4G25700 64.557 2.10e-145 409.0
Mimi2g00496 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 85.878 2.44e-167 461.0
Mimi1g01589 ACH 33 294 Chloroplast and Mitochondria gene family AT1G25380 28.873 3.66e-13 69.7
Mimi1g01866 . 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.344 0.0 567.0
Mimi1g02025 . 1 251 Chloroplast and Mitochondria gene family AT2G17270 58.964 2.25e-107 310.0
Mimi1g02159 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.433 9.82e-172 473.0
Mimi1g02160 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29910 88.433 3.35e-171 471.0
Mimi1g02374 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.201 1.44e-42 147.0
Mimi1g02570 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 65.789 3.23e-111 317.0
Mimi1g02719 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.806 0.0 511.0
Mimi1g02750 . 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.882 0.0 578.0
Mimi1g03565 WGDA 1 215 Chloroplast and Mitochondria gene family AT4G25570 69.767 2.00e-109 321.0