AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Pdy4g00473 ATGGCAACACAAGCTTTGGCCTCATCATCATCACTTACCTCCTCAGTTGAGTCTGCAAGGCAGATCCTTGGAGCAAGGCCAGTTTTCACACCTTCAAGAAAGCTTTCATTTCTTGTCAAAGCTGCTTCCACCCCTCCTGTTAAGCAAGGAGCAGACAGACAACTCTGGTTTGCATCCAAGCAATCTCTTTCTTACCTGGATGGAAGTCTCCCAGGTGACTTTGGATTTGACCCACTTGGTCTTTCGGACCCAGAAGGAACCGGAGGATTCATCGAACCCAAATGGCTAGCTTACGGAGAGGTTATCAATGGACGGTTCGCCATGTTGGGTGCAGCCGGAGCCATCGCACCAGAAATCTTGGGCAAGCTTGGGCTCATCCCAGCAGAAACCGCCCTCCCCTGGTTCAAGACAGGTGTCATCCCTCCAGCTGGCACATACAACTACTGGGCAGACCCTTTCACCCTATTCGTTTTAGAAATGGCACTTATGGGCTTTGCAGAACACAGAAGACTTCAAGATTGGTACAACCCTGGGTCAATGGGAAAGCAATACTTTTTGGGTTTGGAGAAAGGCTTTTCCGGGTCGGGTGACCCAGCATACCCAGGTGGGCCATTCTTTAACCCATTAGGGTTTGGGAAAGATGAGAAGTCAATGAAGGAATTGAAGCTGAAAGAGATCAAGAATGGTAGATTGGCAATGTTGGCTGTGTTGGGTTACTTCATTCAAGGTTTGGTGACTGGGGTTGGACCTTTCCAGAACCTTCTGGACCATTTGGCTGACCCTGTGAACAACAATGTCTTGACCAGCCTTAAGTTCCACTAG 822 49.03 MATQALASSSSLTSSVESARQILGARPVFTPSRKLSFLVKAASTPPVKQGADRQLWFASKQSLSYLDGSLPGDFGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEILGKLGLIPAETALPWFKTGVIPPAGTYNYWADPFTLFVLEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAVLGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 273
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Pdy4g00473 273 Gene3D Chlorophyll a-b binding protein domain 54 272 - -
Pdy4g00473 273 SUPERFAMILY Chlorophyll a-b binding protein 52 269 - -
Pdy4g00473 273 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 8 268 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Pdy4g00473 273 Pfam Chlorophyll A-B binding protein 64 243 IPR022796 -
Pdy4g00473 273 FunFam Chlorophyll a-b binding protein, chloroplastic 54 272 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Pdy4g00473 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Pdy Pdy-Chr4:8760821 Pdy6g02928 Pdy-Chr6:70522134 dispersed
Pdy Pdy-Chr4:8760821 Pdy3g00849 Pdy-Chr3:16140241 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Pdy1g01648 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 7.77e-169 465.0
Pdy1g01649 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 1.53e-168 464.0
Pdy1g01652 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.768 9.68e-168 462.0
Pdy1g01654 . 106 266 Chloroplast and Mitochondria gene family AT2G34430 88.199 3.22e-99 285.0
Pdy1g01656 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 9.68e-168 462.0
Pdy1g02461 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.948 8.58e-168 467.0
Pdy1g02922 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 3.84e-34 109.0
Pdy1g02966 ACH 1 329 Chloroplast and Mitochondria gene family AT2G30160 71.212 3.30e-169 472.0
Pdy1g03108 . 51 447 Chloroplast and Mitochondria gene family AT2G28800 77.861 0.0 609.0
Pdy1g04029 . 45 270 Chloroplast and Mitochondria gene family AT4G03320 36.052 2.36e-44 150.0
Pdy1g04579 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.5 3.21e-144 401.0
Pdy1g05029 ACH 1 223 Chloroplast and Mitochondria gene family AT1G14730 57.589 1.43e-87 256.0
Pdy1g05030 . 4 214 Chloroplast and Mitochondria gene family AT4G25570 43.602 1.02e-60 189.0
Pdy1g05284 . 33 404 Chloroplast and Mitochondria gene family AT2G28800 59.848 1.23e-158 458.0
Pdy1g05593 ACH 33 319 Chloroplast and Mitochondria gene family AT1G25380 68.858 3.61e-144 410.0
Pdy2g00599 . 7 211 Chloroplast and Mitochondria gene family AT4G25570 44.39 1.15e-56 178.0
Pdy2g00600 ACH 22 224 Chloroplast and Mitochondria gene family AT5G38630 44.828 5.94e-55 173.0
Pdy2g00795 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 1.01e-171 473.0
Pdy2g03101 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 31.429 1.95e-31 123.0
Pdy3g00492 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 6.10e-123 349.0
Pdy3g00497 . 70 354 Chloroplast and Mitochondria gene family AT5G54290 79.298 2.65e-147 416.0
Pdy3g00598 ACH 1 365 Chloroplast and Mitochondria gene family AT5G14040 74.521 0.0 556.0
Pdy3g00849 ACH 34 255 Chloroplast and Mitochondria gene family AT3G61470 53.153 7.64e-76 229.0
Pdy3g02469 ACH 174 307 Chloroplast and Mitochondria gene family AT1G25380 33.333 3.19e-19 80.9
Pdy3g02841 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.982 2.24e-110 315.0
Pdy3g03126 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 77.957 0.0 575.0
Pdy3g03256 . 1 236 Chloroplast and Mitochondria gene family AT1G26100 64.082 1.99e-96 280.0
Pdy3g03316 ACH 33 310 Chloroplast and Mitochondria gene family AT1G25380 69.039 3.07e-138 393.0
Pdy3g03626 . 1 305 Chloroplast and Mitochondria gene family AT2G17270 66.557 9.82e-161 448.0
Pdy3g04122 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 91.031 6.44e-151 420.0
Pdy3g04709 . 28 354 Chloroplast and Mitochondria gene family AT2G28800 19.648 9.66e-06 46.2
Pdy4g00473 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.672 3.88e-170 469.0
Pdy4g00657 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.658 1.15e-122 348.0
Pdy4g02356 ACH 1 346 Chloroplast and Mitochondria gene family AT1G72820 61.85 3.34e-139 396.0
Pdy4g02367 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 6.86e-34 108.0
Pdy4g02779 . 52 548 Chloroplast and Mitochondria gene family AT2G18710 83.099 0.0 830.0
Pdy4g03159 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 68.78 1.44e-102 297.0
Pdy4g04063 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 1.12e-170 470.0
Pdy4g04064 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 2.22e-170 469.0
Pdy5g00341 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 75.068 0.0 551.0
Pdy5g01703 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 85.036 9.02e-165 457.0
Pdy6g00734 . 23 300 Chloroplast and Mitochondria gene family AT4G25700 70.486 1.49e-148 418.0
Pdy6g01966 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.129 0.0 513.0
Pdy6g02250 . 173 264 Chloroplast and Mitochondria gene family AT5G15640 72.826 1.13e-39 134.0
Pdy6g02253 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 76.115 0.0 503.0
Pdy6g02846 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 84.286 4.89e-154 429.0
Pdy6g02928 . 37 254 Chloroplast and Mitochondria gene family AT3G61470 46.154 5.40e-60 190.0
Pdy6g03337 ACH 35 255 Chloroplast and Mitochondria gene family AT3G61470 51.131 4.29e-73 222.0
Pdy6g03448 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 71.237 0.0 518.0
Pdy6g03591 . 26 307 Chloroplast and Mitochondria gene family AT5G40810 87.589 2.17e-175 486.0
Pdy6g03761 ACH 5 187 Chloroplast and Mitochondria gene family AT1G17530 68.817 2.50e-80 235.0
Pdy6g03768 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 68.82 5.00e-175 488.0
Pdy7g00591 . 168 266 Chloroplast and Mitochondria gene family AT2G34430 90.909 5.39e-58 177.0
Pdy7g00592 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 7.52e-169 465.0
Pdy7g00593 . 35 266 Chloroplast and Mitochondria gene family AT2G34430 83.19 1.40e-136 382.0
Pdy7g00597 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 87.266 4.16e-168 463.0
Pdy7g00598 . 168 265 Chloroplast and Mitochondria gene family AT2G05070 82.653 1.53e-55 171.0
Pdy7g00599 . 3 129 Chloroplast and Mitochondria gene family AT1G29930 77.953 2.54e-65 197.0
Pdy7g00601 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 88.015 9.47e-169 465.0
Pdy7g00602 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.45e-167 462.0
Pdy7g01322 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.375 4.77e-152 422.0
Pdy7g01643 . 1 139 Chloroplast and Mitochondria gene family AT1G07020 42.446 2.72e-21 81.6
Pdy7g01871 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.014 1.50e-168 471.0
Pdy7g02007 ACH 4 187 Chloroplast and Mitochondria gene family AT1G17530 63.043 7.07e-75 221.0
Pdy8g00023 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 80.282 1.19e-176 491.0
Pdy8g01930 ACH 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.5 2.90e-47 159.0
Pdy8g02174 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 70.614 4.07e-119 337.0
Pdy8g02377 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.295 0.0 499.0
Pdy8g02418 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 79.032 0.0 588.0
Pdy8g03127 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 25.902 7.22e-30 115.0
Pdy8g03379 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 64.854 3.09e-110 315.0
Pdy9g00356 . 37 309 Chloroplast and Mitochondria gene family AT1G25380 26.875 1.34e-33 125.0
Pdy9g01463 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.769 1.65e-148 413.0
Pdy9g01788 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 4.24e-180 494.0