AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Pslu1g21027 ATGGCTGCAGCTGCTAGCTCCACAACTGTGGTCAAGGCCACCCCATTCTTGGGTCAGACTAGATCATCTAACATCAACTCATTAAGAGATGTTGTCTCCATGCCAAGTGCCAAATTCACCATGGGAAATGACTTGTGGTATGGACCGGACCGTGTTAAGTACTTGGGACCATTTTCGGCTCAAACCCCGTCTTACTTGAACGGTGAATTCCCCGGTGATTACGGCTGGGACACCGCTGGTTTGTCTGCTGATCCCGAGGCTTTCGCTAAGAACAGGGCTCTTGAGGTTATCCACGGGCGATGGGCCATGCTTGGCGCACTAGGGTGCATCACACCTGAGGTTCTCGAAAAATGGGTGAAGGTGGACTTCAAGGAGCCCGTTTGGTTCAAGGCCGGAGCCCAAATCTTCTCGGAAGGTGGTCTAGACTACTTGGGGAACCCAAACCTTGTCCATGCTCAGAGCATATTGGCTGTGCTCGGGTTCCAAGTGATCCTAATGGGCCTTGTTGAGGGGTTCCGTATTAACGGGCTTGACGGGGTTGGAGATGGTAACAACCTGTACCCAGGTGGTCAATATTTTGACCCATTGGGCCTTGCAGATGACCCGGTGACTTTCGCTGAGTTGAAGGTGAAGGAGATCAAGAATGGAAGGCTAGCAATGTTTTCAATGTTTGGGTTCTTTGTGCAAGCAATCGTGACAGGAAAAGGCCCATTGGAGAACCTTTTGGACCATTTGGACAACCCGGTAGCTAACAATGCATGGGTCTATGCCACCAAGTTTGTGCCTGGGTCATAG 795 51.07 MAAAASSTTVVKATPFLGQTRSSNINSLRDVVSMPSAKFTMGNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWVKVDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVILMGLVEGFRINGLDGVGDGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGS 264
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Pslu1g21027 264 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 10 263 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Pslu1g21027 264 FunFam Chlorophyll a-b binding protein, chloroplastic 53 257 - -
Pslu1g21027 264 Pfam Chlorophyll A-B binding protein 63 231 IPR022796 -
Pslu1g21027 264 SUPERFAMILY Chlorophyll a-b binding protein 45 261 - -
Pslu1g21027 264 Gene3D Chlorophyll a-b binding protein domain 53 257 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Pslu1g21027 K08914 light-harvesting complex II chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Pslu Pslu-Chr1:7993249 Pslu1g21027 Pslu-Chr1:151354904 dispersed
Pslu Pslu-Chr1:151354904 Pslu3g16428 Pslu-Chr3:117717298 dispersed
Pslu Pslu-Chr1:151354904 Pslu2g00652 Pslu-Chr2:4190864 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Pslu1g01253 . 42 327 Chloroplast and Mitochondria gene family AT1G76570 81.818 0.0 505.0
Pslu1g01643 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 9.57e-172 473.0
Pslu1g01645 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 4.25e-173 476.0
Pslu1g02407 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 32.5 1.38e-32 126.0
Pslu1g05701 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 2.45e-172 474.0
Pslu1g05702 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 4.56e-173 476.0
Pslu1g06381 . 39 214 Chloroplast and Mitochondria gene family AT4G25570 44.318 6.59e-51 162.0
Pslu1g07609 . 45 548 Chloroplast and Mitochondria gene family AT2G18710 83.008 0.0 845.0
Pslu1g08481 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 65.278 1.51e-33 108.0
Pslu1g08522 . 1 338 Chloroplast and Mitochondria gene family AT1G72820 65.976 1.13e-153 433.0
Pslu1g08533 . 218 269 Chloroplast and Mitochondria gene family AT5G40810 88.462 1.45e-25 96.7
Pslu1g09500 . 3 146 Chloroplast and Mitochondria gene family AT1G07020 45.033 1.71e-24 90.9
Pslu1g11275 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 67.317 2.45e-100 294.0
Pslu1g21027 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.041 1.94e-121 345.0
Pslu1g21436 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.281 6.50e-169 466.0
Pslu2g00216 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 33.214 2.85e-34 125.0
Pslu2g00652 . 2 264 Chloroplast and Mitochondria gene family AT2G05100 66.917 3.29e-122 347.0
Pslu2g00657 . 5 354 Chloroplast and Mitochondria gene family AT5G54290 68.347 2.17e-148 421.0
Pslu2g00800 ACH 1 369 Chloroplast and Mitochondria gene family AT5G14040 73.442 0.0 547.0
Pslu2g01177 . 41 255 Chloroplast and Mitochondria gene family AT3G61470 52.558 7.44e-75 226.0
Pslu2g02519 ACH 1 217 Chloroplast and Mitochondria gene family AT5G38630 45.291 1.79e-51 164.0
Pslu2g03146 ACH 29 296 Chloroplast and Mitochondria gene family AT2G47490 36.101 3.18e-46 157.0
Pslu2g03155 . 29 296 Chloroplast and Mitochondria gene family AT2G47490 36.823 9.66e-47 158.0
Pslu2g07136 . 1 305 Chloroplast and Mitochondria gene family AT2G17270 66.885 4.90e-161 449.0
Pslu2g11840 . 10 318 Chloroplast and Mitochondria gene family AT1G25380 66.346 3.52e-145 412.0
Pslu2g12634 . 10 229 Chloroplast and Mitochondria gene family AT1G26100 64.629 4.72e-91 266.0
Pslu2g13704 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 77.957 0.0 585.0
Pslu2g15364 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 90.583 4.38e-150 418.0
Pslu2g15820 . 127 354 Chloroplast and Mitochondria gene family AT2G28800 21.138 1.25e-08 55.8
Pslu3g00967 ACH 1 366 Chloroplast and Mitochondria gene family AT5G14040 75.683 0.0 559.0
Pslu3g10249 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 83.264 1.67e-146 407.0
Pslu3g16390 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 89.844 4.11e-172 474.0
Pslu3g16427 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 1.42e-180 495.0
Pslu3g16428 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 1.69e-180 495.0
Pslu3g16429 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 3.05e-180 494.0
Pslu3g16898 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.008 5.28e-151 419.0
Pslu3g17286 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 64.723 1.09e-150 426.0
Pslu3g17914 . 175 209 Chloroplast and Mitochondria gene family AT5G40810 80.0 3.48e-16 69.3
Pslu4g00152 . 1 215 Chloroplast and Mitochondria gene family AT4G25570 65.581 2.27e-104 300.0
Pslu4g00604 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 25.89 9.55e-29 112.0
Pslu4g01699 ACH 2 369 Chloroplast and Mitochondria gene family AT5G14040 78.261 0.0 573.0
Pslu4g01762 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.129 0.0 511.0
Pslu4g02056 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 71.053 2.35e-119 337.0
Pslu4g02455 ACH 33 308 Chloroplast and Mitochondria gene family AT1G25380 36.491 2.98e-47 161.0
Pslu4g02635 . 6 303 Chloroplast and Mitochondria gene family AT2G17270 67.45 1.98e-153 430.0
Pslu4g03971 ACH 3 221 Chloroplast and Mitochondria gene family AT1G14730 42.466 3.69e-59 184.0
Pslu4g04251 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 1.23e-172 475.0
Pslu5g00359 . 171 287 Chloroplast and Mitochondria gene family AT5G01530 82.906 4.37e-63 193.0
Pslu5g00361 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.847 2.85e-162 451.0
Pslu5g12291 . 14 224 Chloroplast and Mitochondria gene family AT1G14730 60.664 1.46e-86 254.0
Pslu5g12292 ACH 5 208 Chloroplast and Mitochondria gene family AT4G25570 44.39 6.90e-57 179.0
Pslu5g12632 . 33 319 Chloroplast and Mitochondria gene family AT1G25380 67.241 3.85e-141 402.0
Pslu5g13347 . 72 407 Chloroplast and Mitochondria gene family AT2G28800 61.905 4.00e-154 447.0
Pslu5g14053 . 46 271 Chloroplast and Mitochondria gene family AT4G03320 35.931 4.49e-47 157.0
Pslu5g14393 . 1 238 Chloroplast and Mitochondria gene family AT2G34430 65.126 7.30e-94 276.0
Pslu5g14394 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 6.01e-166 458.0
Pslu5g14395 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 2.13e-166 459.0
Pslu5g14396 . 2 267 Chloroplast and Mitochondria gene family AT1G29930 85.714 1.31e-165 457.0
Pslu5g14397 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 9.16e-169 465.0
Pslu5g14398 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 87.97 1.53e-168 464.0
Pslu5g14767 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.695 1.24e-148 414.0
Pslu5g15241 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 87.547 2.86e-179 491.0
Pslu5g15690 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 63.043 1.18e-74 221.0
Pslu5g15912 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.594 2.40e-169 473.0
Pslu6g01091 . 19 300 Chloroplast and Mitochondria gene family AT4G25700 65.714 1.70e-145 410.0
Pslu6g03070 . 11 320 Chloroplast and Mitochondria gene family AT5G15640 76.129 0.0 501.0
Pslu6g03071 . 11 320 Chloroplast and Mitochondria gene family AT5G15640 68.387 1.17e-166 464.0
Pslu6g07516 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 87.097 0.0 517.0
Pslu6g13022 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 85.0 1.08e-155 434.0
Pslu6g13023 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 85.053 3.75e-155 432.0
Pslu6g13259 . 4 580 Chloroplast and Mitochondria gene family AT4G21490 68.847 0.0 822.0
Pslu6g13517 . 34 255 Chloroplast and Mitochondria gene family AT3G61470 45.333 8.67e-62 194.0
Pslu6g14576 . 35 255 Chloroplast and Mitochondria gene family AT3G61470 52.036 1.71e-74 225.0
Pslu6g15210 ACH 54 367 Chloroplast and Mitochondria gene family AT5G14040 76.752 0.0 510.0
Pslu6g15688 . 42 307 Chloroplast and Mitochondria gene family AT5G40810 92.857 3.72e-175 483.0
Pslu6g16110 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.318 4.24e-174 486.0
Pslu7g11278 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 26.462 9.92e-31 120.0
Pslu7g11325 . 8 307 Chloroplast and Mitochondria gene family AT2G47490 78.073 6.15e-164 457.0
Pslu7g12092 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 1.40e-34 110.0
Pslu7g12202 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.646 1.17e-169 473.0
Pslu7g12403 . 27 450 Chloroplast and Mitochondria gene family AT2G28800 74.074 0.0 622.0