AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Sain12g00483 ATGGCAACTCAAGCTTTGGTCTCATCTTCATCACTCACCTCCTCAGTGGAGTCTGCTAGACAAATCTTTGGAGCAAGGCCACTTCATTCTTCTTCAAGAAAGCTCTCCTTTCTTGTCAAAGCTGCTTCCACTCCTCCTGTTAAGCAAGGAGCAAACAGACAACTGTGGTTTGCATCCAAGCAATCTCTTTCTTACCTGGATGGGAGTCTCCCAGGTGACTTCGGATTCGACCCACTTGGTCTCTCCGACCCAGAAGGCACCGGAGGCTTCATCGAACCCAGGTGGCTAGCTTACGGAGAAGTCATCAACGGCCGGTTCGCCATGTTGGGTGCAGCCGGAGCCATCGCACCCGAGATCTTCGGCAAACTTGGGCTCATCCCACCCGAGACCGCCCTCCCCTGGTTCCAGACCGGTGTCATCCCCCCAGCCGGCACCTACAACTACTGGGCCGACCCTTACACCCTTTTCGTAATGGAAATGGCTTTCATGGGCTTTGCAGAGCACAGAAGATTCCAAGATTGGTACAACCCCGGGTCAATGGGTAAACAATATTTCTTGGGGCTAGAGAAGGGGTTTTCCGGGTCGGGTGACCCGGCTTACCCGGGTGGGCCGTTTTTTAACCCACTAGGGTTTGGGAAAGATGAGAAATCAATGAAGGAATTGAAGCTGAAGGAGATTAAGAATGGGAGATTGGCTATGTTGGCTATCTTGGGTTATTTCATTCAGGGTTTGGTGACTGGGGTTGGACCTCTCCAGAACCTTCTGGACCATTTGGCTGACCCGGTCAACAACAATGTGTTGACCAGCCTTAAGTTCCACTAG 822 51.95 MATQALVSSSSLTSSVESARQIFGARPLHSSSRKLSFLVKAASTPPVKQGANRQLWFASKQSLSYLDGSLPGDFGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAAGAIAPEIFGKLGLIPPETALPWFQTGVIPPAGTYNYWADPYTLFVMEMAFMGFAEHRRFQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQGLVTGVGPLQNLLDHLADPVNNNVLTSLKFH 273
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Sain12g00483 273 Pfam Chlorophyll A-B binding protein 64 243 IPR022796 -
Sain12g00483 273 SUPERFAMILY Chlorophyll a-b binding protein 52 269 - -
Sain12g00483 273 Gene3D Chlorophyll a-b binding protein domain 54 272 - -
Sain12g00483 273 FunFam Chlorophyll a-b binding protein, chloroplastic 54 272 - -
Sain12g00483 273 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 14 268 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Sain12g00483 K08909 light-harvesting complex I chlorophyll a/b binding protein 3
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
138750 Sain12g00483 Sain13g02318
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Sain Sain-Chr12:10524108 Sain7g00824 Sain-Chr7:75546021 dispersed
Sain Sain-Chr12:10524108 Sain13g02318 Sain-Chr13:130938847 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Sain1g00819 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 1.76e-171 472.0
Sain1g00820 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 1.82e-171 472.0
Sain3g00283 . 5 187 Chloroplast and Mitochondria gene family AT1G17530 65.241 3.61e-74 219.0
Sain3g01034 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.625 1.88e-151 421.0
Sain3g01666 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.725 8.30e-168 469.0
Sain3g03214 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 84.307 5.15e-164 455.0
Sain3g03904 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 62.5 3.82e-31 102.0
Sain3g04198 . 1 301 Chloroplast and Mitochondria gene family AT2G47490 76.821 1.45e-164 458.0
Sain4g00295 . 42 407 Chloroplast and Mitochondria gene family AT2G28800 58.568 1.99e-154 447.0
Sain4g00427 ACH 1 224 Chloroplast and Mitochondria gene family AT1G14730 59.375 1.65e-93 271.0
Sain4g00428 ACH 18 222 Chloroplast and Mitochondria gene family AT1G14730 44.39 7.29e-60 186.0
Sain4g00612 ACH 33 351 Chloroplast and Mitochondria gene family AT1G25380 62.539 9.79e-143 407.0
Sain4g01398 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 86.307 2.07e-144 402.0
Sain4g02334 . 46 275 Chloroplast and Mitochondria gene family AT4G03320 37.5 2.27e-47 157.0
Sain4g03053 . 1 266 Chloroplast and Mitochondria gene family AT1G29930 79.926 1.43e-156 434.0
Sain5g01616 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 76.115 0.0 501.0
Sain5g01893 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.161 0.0 514.0
Sain6g00474 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 75.549 0.0 557.0
Sain6g01373 . 104 247 Chloroplast and Mitochondria gene family AT1G76570 69.643 8.11e-80 238.0
Sain7g00481 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 81.071 5.97e-147 411.0
Sain7g00483 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 84.643 2.27e-155 433.0
Sain7g00824 . 38 254 Chloroplast and Mitochondria gene family AT3G61470 46.818 2.56e-61 192.0
Sain7g01342 ACH 35 255 Chloroplast and Mitochondria gene family AT3G61470 50.679 1.85e-71 217.0
Sain7g01652 . 104 304 Chloroplast and Mitochondria gene family AT1G76570 73.333 2.35e-118 339.0
Sain7g01806 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 73.442 0.0 534.0
Sain7g01976 . 26 307 Chloroplast and Mitochondria gene family AT5G40810 86.316 1.14e-174 485.0
Sain7g02172 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 70.621 0.0 505.0
Sain8g00803 . 17 300 Chloroplast and Mitochondria gene family AT4G25700 66.774 4.31e-147 414.0
Sain8g02467 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 64.912 1.15e-106 305.0
Sain8g02960 ACH 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.676 4.77e-49 164.0
Sain9g00298 ACH 1 369 Chloroplast and Mitochondria gene family AT5G14040 75.068 0.0 555.0
Sain9g00602 ACH 32 255 Chloroplast and Mitochondria gene family AT3G61470 52.679 1.56e-75 228.0
Sain9g01840 . 41 322 Chloroplast and Mitochondria gene family AT1G07030 32.746 4.24e-33 122.0
Sain9g02630 . 56 92 Chloroplast and Mitochondria gene family AT5G40810 81.081 2.29e-17 74.7
Sain9g03569 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 2.17e-172 474.0
Sain9g03746 ACH 4 211 Chloroplast and Mitochondria gene family AT4G25570 44.712 2.65e-61 190.0
Sain10g00670 . 1 101 Chloroplast and Mitochondria gene family AT2G30160 64.356 1.51e-43 142.0
Sain10g01371 . 44 321 Chloroplast and Mitochondria gene family AT2G30160 31.56 1.21e-32 126.0
Sain10g03707 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 89.686 1.11e-148 414.0
Sain10g03713 . 40 106 Chloroplast and Mitochondria gene family AT1G76570 62.687 1.43e-23 89.7
Sain10g04296 ACH 1 305 Chloroplast and Mitochondria gene family AT2G17270 65.798 1.08e-156 438.0
Sain10g04416 . 190 296 Chloroplast and Mitochondria gene family AT1G25380 26.446 5.27e-08 48.5
Sain10g04724 ACH 7 313 Chloroplast and Mitochondria gene family AT1G25380 66.774 3.41e-146 414.0
Sain10g04840 . 10 236 Chloroplast and Mitochondria gene family AT1G26100 67.089 7.56e-96 278.0
Sain11g00174 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 65.272 6.68e-110 313.0
Sain11g00581 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 25.407 7.96e-29 112.0
Sain11g01567 . 2 365 Chloroplast and Mitochondria gene family AT5G14040 78.297 0.0 580.0
Sain11g01660 ACH 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.806 0.0 508.0
Sain11g01946 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 69.298 6.79e-118 333.0
Sain11g02326 ACH 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.5 5.35e-46 156.0
Sain11g02440 . 5 305 Chloroplast and Mitochondria gene family AT2G17270 66.777 1.93e-153 431.0
Sain11g02727 . 33 313 Chloroplast and Mitochondria gene family AT1G25380 27.778 3.51e-15 73.6
Sain11g04751 . 29 327 Chloroplast and Mitochondria gene family AT1G76570 78.073 2.32e-178 494.0
Sain12g00283 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.041 1.06e-121 346.0
Sain12g00483 ACH 18 273 Chloroplast and Mitochondria gene family AT1G61520 89.062 1.26e-170 470.0
Sain12g01628 . 1 329 Chloroplast and Mitochondria gene family AT2G30160 69.091 2.84e-165 461.0
Sain12g01682 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 83.942 3.21e-165 458.0
Sain12g01991 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.708 9.09e-29 112.0
Sain13g01282 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 66.472 3.36e-157 442.0
Sain13g01823 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.008 1.47e-149 416.0
Sain13g02244 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 89.057 2.83e-180 494.0
Sain13g02318 ACH 19 273 Chloroplast and Mitochondria gene family AT1G61520 89.105 7.28e-171 471.0
Sain14g01731 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 3.15e-170 469.0
Sain14g01733 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 2.60e-171 471.0
Sain14g01734 ACH 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 4.69e-169 466.0
Sain15g00853 . 51 448 Chloroplast and Mitochondria gene family AT2G28800 76.119 0.0 596.0
Sain15g01036 . 1 325 Chloroplast and Mitochondria gene family AT2G30160 71.779 8.37e-168 468.0
Sain15g01125 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 6.18e-32 103.0
Sain16g00433 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 68.599 3.56e-104 301.0
Sain16g01170 . 60 548 Chloroplast and Mitochondria gene family AT2G18710 83.845 0.0 827.0
Sain16g01763 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 65.278 1.36e-32 105.0
Sain16g02248 . 3 143 Chloroplast and Mitochondria gene family AT1G07020 48.0 2.10e-32 111.0
Sain10001228.1g00002 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.29e-122 348.0
Sain10001229.1g00002 . 26 354 Chloroplast and Mitochondria gene family AT5G54290 70.821 1.26e-146 416.0
Sain10001257.1g00004 . 56 91 Chloroplast and Mitochondria gene family AT5G40810 86.111 5.60e-18 74.7