AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Smso1g03611 ATGGGTATCGATCTTGTTGCCGGTGGTAAGAGCAAGAGAACCAAAAGAACCGCCCCTAGATCCGACGATATCTACCTGAAACTTCTCGTCAAGCTTTACCGGTTTCTGGTGAGAAGGACCGGAAGCAACTTCAATGCTGTGATACTGAAGAGGCTCTTCATGAGCAAAGTCAACAAGCCTCCGATCTCCCTATCTCGCCTGATTCGTTACATGTCCGGCAAGGACGATAAGATTGCTGTGGTTGTTGGAACGGTTACGGATGATGTTAGGGTGCATGAAATCCCTTGCTTGAAGGTGACTGCATTGAGGTTTACCGAGACTGCTAGGGCTAGGATTGAGAAGGCTGGTGGAGAGTGTTTGACCTTTGATCAGCTGGCTCTTCGAGCTCCTCTTGGACAGAACACTGTTCTTCTTAGAGGTCCAAAGAACTCCCGTGAAGCGGTGAAGCACTTTGGTAAGGCTCCCGGTGTACCACACAGTCACACCAAGCCTTATGTGAGATCAAAGGGAAGGAAGTTTGAGAAGGCCAGAGGTAGAAGAAACAGCAGGGGATTTAGAAACTAA 564 48.76 MGIDLVAGGKSKRTKRTAPRSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIRYMSGKDDKIAVVVGTVTDDVRVHEIPCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRN 187
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Smso1g03611 187 FunFam 60S ribosomal protein L18 1 187 - -
Smso1g03611 187 SUPERFAMILY Ribosomal proteins L15p and L18e 21 139 IPR036227 -
Smso1g03611 187 MobiDBLite consensus disorder prediction 151 187 - -
Smso1g03611 187 Gene3D - 1 187 - -
Smso1g03611 187 PANTHER 60S RIBOSOMAL PROTEIN L18 1 187 IPR000039 GO:0003723(PANTHER)|GO:0003735(PANTHER)|GO:0003735(InterPro)|GO:0005840(InterPro)|GO:0006412(InterPro)|GO:0022625(PANTHER)
Smso1g03611 187 Pfam Ribosomal protein 60S L18 and 50S L18e 2 186 IPR021131 -
Smso1g03611 187 MobiDBLite consensus disorder prediction 164 187 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Smso1g03611 K02883 large subunit ribosomal protein L18e
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
141539 Smso10g00678 Smso1g03611
149178 Smso1g03611 Smso20g00786
149179 Smso1g03611 Smso21g02269
149180 Smso1g03611 Smso26g00052
337985 Smso28g00483 Smso1g03611
346432 Smso20g01828 Smso1g03611
357502 Smso1g03611 Smso28g00483
429044 Smso1g03611 Smso20g01828
429045 Smso1g03611 Smso28g00483
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
4960285 Smso Smso17g02399 Smso-Chr17:30489140 Smso1g03611 Smso-Chr1:121449405
4967755 Smso Smso1g03611 Smso-Chr1:121449405 Smso21g02269 Smso-Chr21:32401797
5023263 Smso Smso1g03611 Smso-Chr1:121449405 Smso10g00678 Smso-Chr10:7132266
5025349 Smso Smso1g03611 Smso-Chr1:121449405 Smso20g01828 Smso-Chr20:61697138
5025425 Smso Smso1g03611 Smso-Chr1:121449405 Smso20g00786 Smso-Chr20:13705853
5027033 Smso Smso1g03611 Smso-Chr1:121449405 Smso26g00052 Smso-Chr26:520154
5027962 Smso Smso1g03611 Smso-Chr1:121449405 Smso28g00483 Smso-Chr28:13375333
5028301 Smso Smso1g03611 Smso-Chr1:121449405 Smso29g01597 Smso-Chr29:42991926
5028931 Smso Smso1g03611 Smso-Chr1:121449405 Smso4g02371 Smso-Chr4:39222908
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
SmsoJAKNSE010000062g00021 . 26 136 Cytoplasmic Ribosomal Protein gene family AT3G04400 33.913 2.86e-14 67.0
SmsoJAKNSE010000056g00008 . 14 148 Cytoplasmic Ribosomal Protein gene family AT5G15200 29.787 1.33e-06 48.1
SmsoJAKNSE010000056g00013 . 106 148 Cytoplasmic Ribosomal Protein gene family AT5G39850 48.837 2.95e-06 44.3
SmsoJAKNSE010000045g00012 . 28 137 Cytoplasmic Ribosomal Protein gene family AT2G36160 35.455 1.34e-13 62.0
SmsoJAKNSE010000045g00015 . 26 136 Cytoplasmic Ribosomal Protein gene family AT3G04400 33.913 4.89e-16 67.8
SmsoJAKNSE010000045g00017 . 108 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 46.296 8.47e-21 83.2
SmsoJAKNSE010000045g00020 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
SmsoJAKNSE010000037g00119 . 84 161 Cytoplasmic Ribosomal Protein gene family AT2G47610 53.086 2.41e-16 70.5
SmsoJAKNSE010000037g00227 . 28 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 79.348 5.58e-48 147.0
SmsoJAKNSE010000034g00009 . 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.857 1.87e-119 336.0
SmsoJAKNSE010000034g00062 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 4.50e-07 47.4
SmsoJAKNSE010000034g00077 . 1 60 Cytoplasmic Ribosomal Protein gene family AT1G80750 53.968 3.09e-11 55.1
SmsoJAKNSE010000034g00204 . 1 143 Cytoplasmic Ribosomal Protein gene family AT2G19730 75.524 1.66e-73 215.0
Smso29g00064 ACH,WGDA 6 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 40.0 1.35e-31 108.0
Smso29g00314 WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.247 7.76e-90 256.0
Smso29g00619 SST 85 133 Cytoplasmic Ribosomal Protein gene family AT5G63070 42.857 2.86e-10 53.1
Smso29g00666 . 55 101 Cytoplasmic Ribosomal Protein gene family AT5G02960 78.723 2.84e-21 82.4
Smso29g00668 . 55 101 Cytoplasmic Ribosomal Protein gene family AT5G02960 78.723 2.84e-21 82.4
Smso29g00670 . 55 101 Cytoplasmic Ribosomal Protein gene family AT5G02960 78.723 2.84e-21 82.4
Smso29g00913 ACH,SST 21 213 Cytoplasmic Ribosomal Protein gene family AT3G11250 21.5 1.39e-09 55.5
Smso29g00955 SST 1 387 Cytoplasmic Ribosomal Protein gene family AT1G61580 87.08 0.0 704.0
Smso29g00956 SST 33 387 Cytoplasmic Ribosomal Protein gene family AT1G61580 85.352 0.0 630.0
Smso29g01040 SST 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 85.185 6.96e-50 150.0
Smso29g01356 ACH 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 2.41e-84 241.0
Smso29g01376 . 1 115 Cytoplasmic Ribosomal Protein gene family AT3G56340 78.261 2.77e-61 184.0
Smso29g01419 . 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso29g01480 WGDA 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 86.26 1.95e-78 226.0
Smso29g01589 . 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.36 7.45e-126 352.0
Smso29g01597 . 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 85.484 6.17e-119 334.0
Smso29g01957 WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.157 4.52e-108 305.0
Smso29g02001 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 69.027 2.20e-33 112.0
Smso29g02006 WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso29g02025 WGDA 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 8.92e-125 350.0
Smso29g02040 . 63 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 63.218 9.21e-27 102.0
Smso29g02336 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.105 1.44e-117 330.0
Smso28g00158 ACH,SST,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 1.60e-92 263.0
Smso28g00237 SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 81.416 7.97e-63 188.0
Smso28g00334 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 87.864 1.26e-136 379.0
Smso28g00363 ACH,SST,WGDA 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.733 5.80e-77 222.0
Smso28g00425 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.06 6.06e-83 241.0
Smso28g00483 ACH,SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 3.13e-120 336.0
Smso28g00606 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.84e-49 155.0
Smso28g00607 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 2.60e-48 156.0
Smso28g00711 . 3 66 Cytoplasmic Ribosomal Protein gene family AT2G34480 82.812 7.89e-36 117.0
Smso28g00785 ACH 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.545 1.80e-124 352.0
Smso28g00802 . 1 47 Cytoplasmic Ribosomal Protein gene family AT3G09500 85.106 3.54e-21 79.7
Smso28g00984 SST 99 216 Cytoplasmic Ribosomal Protein gene family AT3G51190 40.678 4.58e-23 91.3
Smso28g01228 ACH,SST,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.157 3.06e-108 305.0
Smso28g01331 ACH,SST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso28g01399 ACH,SST 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 81.379 4.59e-78 229.0
Smso28g01428 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 44.0 3.06e-10 55.5
Smso28g01607 SST,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 8.66e-58 171.0
Smso28g01635 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 7.15e-47 157.0
Smso28g01689 SST,WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.105 4.02e-117 328.0
Smso28g01694 SST,WGDA 1 82 Cytoplasmic Ribosomal Protein gene family AT3G52590 41.463 5.69e-11 58.9
Smso27g00081 SST 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 1.84e-166 459.0
Smso27g00094 SST 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 39.437 6.55e-08 51.2
Smso27g00146 SST 1 386 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.637 0.0 715.0
Smso27g00249 . 1 61 Cytoplasmic Ribosomal Protein gene family AT3G52590 34.426 1.68e-06 45.4
Smso27g00271 ACH,SST 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 80.102 1.13e-110 313.0
Smso27g00335 ACH,SST 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.86 0.0 496.0
Smso27g00390 ACH,SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 2.42e-64 192.0
Smso27g00517 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 87.671 3.88e-94 273.0
Smso27g00716 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.549 4.10e-172 474.0
Smso27g01127 SST 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 70.504 5.81e-66 194.0
Smso27g01228 SST 1 193 Cytoplasmic Ribosomal Protein gene family AT1G33140 82.902 1.72e-118 332.0
Smso27g01399 ACH,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 1.38e-117 332.0
Smso27g01442 SST 1 68 Cytoplasmic Ribosomal Protein gene family AT3G47370 45.588 7.79e-11 57.8
Smso27g01491 SST,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 87.368 1.93e-57 170.0
Smso27g01825 . 105 206 Cytoplasmic Ribosomal Protein gene family AT2G27530 30.769 6.48e-07 47.4
Smso27g02014 ACH 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 9.55e-96 272.0
Smso27g02085 SST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.482 1.68e-76 224.0
Smso27g02144 ACH,SST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 83.537 6.56e-102 289.0
Smso27g02173 ACH,SST 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 84.817 1.83e-124 350.0
Smso27g02211 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 66.957 1.13e-32 108.0
Smso27g02274 ACH,SST 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 88.554 9.15e-108 303.0
Smso26g00036 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 88.489 1.84e-90 258.0
Smso26g00045 ACH,SST 11 107 Cytoplasmic Ribosomal Protein gene family AT3G05560 84.536 8.23e-44 144.0
Smso26g00052 ACH,SST 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.559 3.84e-120 337.0
Smso26g00129 ACH,SST,WGDA 18 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 43.636 1.65e-07 48.1
Smso26g00264 WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 90.323 4.60e-57 169.0
Smso26g00352 SST 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.87 9.12e-40 128.0
Smso26g00436 ACH,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 4.70e-101 285.0
Smso26g00480 SST,WGDA 15 132 Cytoplasmic Ribosomal Protein gene family AT4G18730 26.562 2.35e-06 45.1
Smso26g00524 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso26g00601 SST,WGDA 44 113 Cytoplasmic Ribosomal Protein gene family AT2G31610 94.286 3.39e-42 135.0
Smso26g00632 ACH,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Smso26g00809 ACH,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 94.203 6.42e-44 134.0
Smso26g00862 ACH,SST,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.328 1.55e-79 229.0
Smso26g00890 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 2.80e-137 380.0
Smso26g00910 ACH,WGDA 53 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 90.123 1.97e-53 160.0
Smso26g00921 ACH,WGDA 48 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 80.556 1.23e-39 125.0
Smso26g01060 ACH,SST,WGDA 100 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 88.108 3.08e-116 329.0
Smso26g01065 ACH,WGDA 1 121 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.562 7.99e-80 232.0
Smso26g01094 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso26g01115 ACH,SST 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 9.48e-93 263.0
Smso26g01268 ACH 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 82.192 0.0 502.0
Smso26g01415 ACH,SST 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.931 0.0 498.0
Smso26g01417 ACH,SST 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.931 0.0 498.0
Smso26g01820 WGDA 21 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 43.885 7.06e-33 112.0
Smso26g02098 WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.247 7.76e-90 256.0
Smso26g02200 . 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 85.024 3.64e-109 310.0
Smso26g02337 ACH,SST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.071 5.08e-74 217.0
Smso26g02383 ACH 1 88 Cytoplasmic Ribosomal Protein gene family AT3G55280 77.273 3.86e-31 105.0
Smso26g02925 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 93.023 2.01e-58 172.0
Smso26g03015 . 54 153 Cytoplasmic Ribosomal Protein gene family AT1G23410 84.0 4.46e-46 145.0
Smso25g00107 SST,WGDA 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 1.46e-90 263.0
Smso25g00220 SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.641 3.09e-163 451.0
Smso25g00448 ACH,SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 81.675 4.09e-113 321.0
Smso25g00449 SST,WGDA 25 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 75.595 7.12e-87 253.0
Smso25g00614 SST,WGDA 23 121 Cytoplasmic Ribosomal Protein gene family AT3G45030 31.0 9.60e-08 47.0
Smso25g00620 SST,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 86.473 5.15e-128 360.0
Smso25g00684 ACH,SST,WGDA 97 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 92.593 3.22e-110 312.0
Smso25g00754 SST,WGDA 13 126 Cytoplasmic Ribosomal Protein gene family AT3G07110 31.061 6.55e-07 46.6
Smso25g00815 SST,WGDA 59 242 Cytoplasmic Ribosomal Protein gene family AT2G01250 89.674 2.57e-123 346.0
Smso25g01181 WGDA 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 5.32e-166 457.0
Smso25g01307 SST,WGDA 3 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 30.882 2.45e-07 48.5
Smso25g01716 ACH,SST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.364 5.96e-86 247.0
Smso25g01766 ACH,SST,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 90.196 1.95e-126 353.0
Smso25g01914 ACH,SST 1 112 Cytoplasmic Ribosomal Protein gene family AT1G07070 89.286 3.38e-74 215.0
Smso25g01989 ACH,SST,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 86.364 1.08e-72 213.0
Smso25g01995 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 7.19e-72 208.0
Smso25g02069 SST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 1.16e-80 232.0
Smso25g02091 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso25g02181 ACH,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Smso25g02300 ACH,SST 1 88 Cytoplasmic Ribosomal Protein gene family AT3G53430 88.636 7.98e-51 155.0
Smso25g02327 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.468 1.11e-33 111.0
Smso25g02330 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso25g02406 . 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 1.50e-71 207.0
Smso25g02415 . 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 8.98e-75 218.0
Smso25g02464 . 1 69 Cytoplasmic Ribosomal Protein gene family AT1G07070 89.855 6.94e-42 131.0
Smso25g02467 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.532 2.38e-176 489.0
Smso25g02594 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 1.45e-82 242.0
Smso25g02606 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 1.18e-58 175.0
Smso25g02635 . 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 1.23e-86 250.0
Smso25g02680 . 1 111 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.288 3.19e-71 206.0
Smso25g02695 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 64.655 6.22e-45 139.0
Smso25g02744 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 88.725 2.17e-124 348.0
Smso25g02852 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 82.222 1.50e-81 235.0
Smso25g02873 . 43 119 Cytoplasmic Ribosomal Protein gene family AT2G16360 81.818 3.91e-43 134.0
Smso24g00038 SST,WGDA 85 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 36.111 1.98e-07 45.8
Smso24g00099 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT2G44860 70.37 1.16e-78 229.0
Smso24g00186 SST,WGDA 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 3.13e-06 43.1
Smso24g00270 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso24g00442 ACH,SST,WGDA 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 80.556 6.86e-148 415.0
Smso24g00494 . 1 36 Cytoplasmic Ribosomal Protein gene family AT4G27090 69.444 9.19e-10 52.8
Smso24g00502 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 72.727 4.47e-74 216.0
Smso24g00530 . 31 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 81.538 3.00e-32 107.0
Smso24g00619 ACH,SST,WGDA 14 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 47.518 1.13e-34 117.0
Smso24g00652 ACH,SST,WGDA 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 84.647 7.03e-153 424.0
Smso24g00661 SST 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.928 7.72e-92 262.0
Smso24g00702 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 2.70e-54 163.0
Smso24g00828 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.679 1.28e-95 271.0
Smso24g00886 . 42 76 Cytoplasmic Ribosomal Protein gene family AT2G16360 77.143 1.49e-13 62.0
Smso24g01040 . 1 176 Cytoplasmic Ribosomal Protein gene family AT4G25740 65.816 1.18e-70 210.0
Smso24g01076 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 4.43e-125 352.0
Smso24g01437 SST,WGDA 48 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 77.778 5.22e-83 246.0
Smso24g01447 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 79.47 7.96e-82 236.0
Smso24g01618 SST 50 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 31.034 7.10e-10 54.3
Smso24g01894 ACH,SST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.278 8.17e-10 55.8
Smso24g02068 ACH,SST 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.405 4.21e-164 457.0
Smso24g02072 ACH,SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 92.391 2.37e-59 174.0
Smso24g02142 ACH,SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 94.203 6.42e-44 134.0
Smso24g02435 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Smso24g02453 SST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 89.732 7.94e-150 416.0
Smso24g02642 SST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.964 3.28e-152 422.0
Smso24g02643 SST,WGDA 10 243 Cytoplasmic Ribosomal Protein gene family AT2G31610 86.441 3.56e-145 404.0
Smso24g02776 ACH,SST,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Smso24g02901 ACH,SST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 36.486 3.76e-07 48.1
Smso23g00170 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.826 3.85e-32 109.0
Smso23g00199 ACH,SST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 1.03e-101 288.0
Smso23g00232 SST,WGDA 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 79.333 8.18e-78 225.0
Smso23g00251 ACH,SST,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 1.32e-95 282.0
Smso23g00322 SST 1 82 Cytoplasmic Ribosomal Protein gene family AT3G06680 65.854 6.18e-33 107.0
Smso23g00362 ACH,SST,WGDA 1 106 Cytoplasmic Ribosomal Protein gene family AT3G52590 35.088 6.93e-09 53.1
Smso23g00433 SST 1 129 Cytoplasmic Ribosomal Protein gene family AT4G29430 74.419 2.24e-74 215.0
Smso23g00434 SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 3.42e-116 329.0
Smso23g00675 SST,WGDA 7 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 77.297 6.32e-109 307.0
Smso23g00859 SST,WGDA 2 151 Cytoplasmic Ribosomal Protein gene family AT1G29970 45.679 2.85e-32 111.0
Smso23g00860 SST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 87.5 1.27e-118 331.0
Smso23g00933 SST,WGDA 1 243 Cytoplasmic Ribosomal Protein gene family AT2G31610 79.424 4.32e-134 375.0
Smso23g00934 SST,WGDA 1 237 Cytoplasmic Ribosomal Protein gene family AT2G31610 87.029 1.83e-152 422.0
Smso23g01136 . 4 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 43.056 3.73e-09 53.9
Smso23g01160 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 1.31e-08 51.2
Smso23g01183 . 118 208 Cytoplasmic Ribosomal Protein gene family AT2G31610 75.824 3.34e-43 140.0
Smso23g01205 . 86 152 Cytoplasmic Ribosomal Protein gene family AT3G02560 62.687 1.48e-23 90.1
Smso23g01316 SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.938 9.28e-171 473.0
Smso23g01447 SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.77 4.84e-65 194.0
Smso22g00072 SST 28 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 76.087 2.58e-44 139.0
Smso22g00292 . 2 51 Cytoplasmic Ribosomal Protein gene family AT3G02190 94.0 1.75e-30 100.0
Smso22g00351 SST 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso22g00383 . 21 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 63.441 8.73e-17 67.8
Smso22g00784 WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 1.63e-06 42.4
Smso22g00802 WGDA 20 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 34.862 3.95e-10 53.5
Smso22g00924 SST 4 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 80.446 0.0 665.0
Smso22g01398 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT3G02080 81.818 9.64e-88 254.0
Smso22g01692 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.795 2.93e-83 239.0
Smso22g01709 SST 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 86.282 1.25e-177 492.0
Smso22g01813 SST 9 211 Cytoplasmic Ribosomal Protein gene family AT2G27530 25.238 4.05e-06 45.8
Smso22g02100 ACH,SST,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT5G61170 86.429 3.09e-91 259.0
Smso22g02138 . 27 91 Cytoplasmic Ribosomal Protein gene family AT1G26880 87.692 3.67e-31 116.0
Smso22g02167 ACH,SST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.963 9.60e-112 316.0
Smso22g02234 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 83.562 5.55e-90 259.0
Smso22g02288 ACH,SST,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.857 1.75e-120 335.0
Smso22g02380 ACH,SST,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 1.63e-07 48.9
Smso22g02402 ACH,SST 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.77 4.11e-66 196.0
Smso22g02406 ACH,SST,WGDA 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 57.2 1.16e-88 270.0
Smso21g00110 . 5 110 Cytoplasmic Ribosomal Protein gene family AT2G40010 50.467 8.61e-28 102.0
Smso21g00245 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.532 7.21e-177 490.0
Smso21g00563 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 5.63e-70 223.0
Smso21g00575 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 9.21e-59 172.0
Smso21g00627 ACH,SST 6 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 89.535 1.42e-107 330.0
Smso21g00667 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 84.932 3.63e-90 256.0
Smso21g00702 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Smso21g00855 ACH,SST 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 1.10e-72 211.0
Smso21g00869 ACH,SST 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 88.961 1.32e-76 223.0
Smso21g00919 ACH,SST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.071 3.72e-73 223.0
Smso21g01039 ACH,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 1.50e-125 351.0
Smso21g01097 ACH,SST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 85.621 3.69e-86 248.0
Smso21g01130 ACH,SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 1.23e-83 243.0
Smso21g01251 . 1 141 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.454 1.44e-99 282.0
Smso21g01253 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.053 8.79e-108 302.0
Smso21g01254 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Smso21g01307 ACH,SST,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 88.235 4.28e-125 349.0
Smso21g01308 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Smso21g01409 ACH,SST,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 1.55e-08 51.6
Smso21g01586 ACH,SST 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 1.10e-119 334.0
Smso21g01689 ACH,SST,WGDA 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 1.47e-58 175.0
Smso21g01733 ACH,SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso21g01739 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.526 1.73e-37 123.0
Smso21g01762 ACH,SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 3.46e-101 285.0
Smso21g01789 ACH,SST,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 82.403 1.98e-126 355.0
Smso21g01806 ACH,SST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso21g02154 ACH,SST 1 260 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.231 0.0 496.0
Smso21g02187 WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso21g02189 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 3.83e-85 245.0
Smso21g02269 ACH,SST 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 5.18e-120 335.0
Smso21g02329 SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 82.791 8.31e-126 352.0
Smso21g02470 . 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 7.11e-99 280.0
Smso21g02531 . 36 122 Cytoplasmic Ribosomal Protein gene family AT4G18100 52.632 1.19e-23 87.4
Smso21g02623 ACH,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 1.95e-92 262.0
Smso21g02778 SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 76.812 4.46e-31 105.0
Smso21g02792 SST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 3.62e-146 409.0
Smso21g03018 ACH,SST,WGDA 127 195 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.435 4.06e-06 43.5
Smso21g03037 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.77 3.69e-168 463.0
Smso20g00234 ACH,SST,WGDA 13 147 Cytoplasmic Ribosomal Protein gene family AT4G00100 66.667 3.28e-53 167.0
Smso20g00413 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso20g00506 ACH,SST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 2.72e-120 335.0
Smso20g00642 ACH,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 8.17e-127 354.0
Smso20g00782 ACH,SST,WGDA 1 205 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.36 4.73e-123 347.0
Smso20g00786 ACH,SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 3.61e-120 336.0
Smso20g00796 ACH,SST,WGDA 31 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 91.489 1.55e-49 151.0
Smso20g00877 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 2.36e-84 243.0
Smso20g00879 ACH,SST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso20g00973 ACH,SST,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.328 2.92e-79 228.0
Smso20g01043 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.835 5.59e-138 382.0
Smso20g01085 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 9.40e-84 239.0
Smso20g01098 ACH,SST,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 81.667 3.46e-69 201.0
Smso20g01225 . 61 170 Cytoplasmic Ribosomal Protein gene family AT4G34670 76.364 5.29e-58 178.0
Smso20g01280 ACH,WGDA 60 272 Cytoplasmic Ribosomal Protein gene family AT1G58983 69.907 1.74e-99 288.0
Smso20g01358 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 2.02e-91 259.0
Smso20g01409 . 4 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.097 7.49e-143 396.0
Smso20g01449 . 1 115 Cytoplasmic Ribosomal Protein gene family AT3G56340 78.261 1.91e-61 184.0
Smso20g01462 . 160 263 Cytoplasmic Ribosomal Protein gene family AT5G39740 71.154 4.66e-49 157.0
Smso20g01608 ACH 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso20g01690 ACH,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.328 4.05e-77 224.0
Smso20g01768 . 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 77.397 3.01e-82 236.0
Smso20g01821 SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.099 9.65e-125 349.0
Smso20g01828 SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 85.484 2.84e-119 335.0
Smso20g01936 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 83.262 2.84e-125 354.0
Smso20g02090 . 75 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 32.593 6.40e-09 50.4
Smso20g02226 ACH,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.759 1.42e-108 305.0
Smso20g02272 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.142 5.53e-33 110.0
Smso20g02277 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 2.27e-128 362.0
Smso20g02305 ACH,WGDA 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 84.817 7.64e-125 350.0
Smso20g02321 . 4 137 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.353 2.08e-72 224.0
Smso20g02456 . 202 298 Cytoplasmic Ribosomal Protein gene family AT5G02870 76.289 4.15e-45 150.0
Smso20g02553 . 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 1.11e-57 171.0
Smso20g02554 WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 1.11e-57 171.0
Smso20g02606 ACH 9 82 Cytoplasmic Ribosomal Protein gene family AT3G06680 74.324 1.36e-32 107.0
Smso20g02619 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.632 6.88e-118 330.0
Smso20g02621 WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G62250 38.889 4.65e-07 47.4
Smso19g00048 ACH,SST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso19g00085 ACH,SST,WGDA 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 83.495 5.53e-110 313.0
Smso19g00130 SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 91.391 2.02e-99 280.0
Smso19g00175 WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 59.483 3.39e-36 120.0
Smso19g00191 SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 3.88e-60 177.0
Smso19g00846 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Smso19g00849 WGDA 1 85 Cytoplasmic Ribosomal Protein gene family AT5G39850 90.588 1.87e-51 157.0
Smso19g00850 SST 120 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 79.412 3.64e-37 121.0
Smso19g01689 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 3.75e-48 157.0
Smso19g01759 SST 1 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.0 9.46e-10 55.8
Smso18g00092 ACH,SST,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 84.167 7.69e-71 206.0
Smso18g00419 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 93.333 3.66e-68 199.0
Smso18g00543 . 68 90 Cytoplasmic Ribosomal Protein gene family AT4G36130 73.913 2.00e-06 42.0
Smso18g00827 . 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Smso18g00887 SST,WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 35.714 9.89e-06 42.7
Smso18g00999 . 56 96 Cytoplasmic Ribosomal Protein gene family AT5G02960 82.927 7.24e-18 72.0
Smso18g01115 ACH,SST,WGDA 21 180 Cytoplasmic Ribosomal Protein gene family AT3G11250 24.242 9.13e-10 55.8
Smso18g01447 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 90.741 2.47e-55 166.0
Smso18g01494 ACH,SST,WGDA 42 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 85.222 7.51e-132 370.0
Smso18g01595 SST,WGDA 13 126 Cytoplasmic Ribosomal Protein gene family AT3G07110 31.061 6.25e-07 46.2
Smso18g01714 ACH,WGDA 97 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 92.593 1.99e-110 313.0
Smso18g01783 ACH,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.507 6.50e-127 356.0
Smso18g01803 SST,WGDA 21 117 Cytoplasmic Ribosomal Protein gene family AT3G47370 30.612 4.52e-07 45.1
Smso18g02012 SST,WGDA 57 186 Cytoplasmic Ribosomal Protein gene family AT3G49010 80.0 3.18e-73 218.0
Smso18g02013 ACH,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 82.723 3.75e-115 327.0
Smso18g02451 ACH,SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 85.496 1.16e-161 456.0
Smso18g02457 ACH 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso18g02483 WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 4.56e-71 207.0
Smso18g02545 WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.679 1.28e-95 271.0
Smso18g02641 SST,WGDA 71 152 Cytoplasmic Ribosomal Protein gene family AT5G09510 92.683 2.69e-54 163.0
Smso18g02642 SST,WGDA 5 149 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.586 3.61e-88 261.0
Smso17g00064 ACH,SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.931 0.0 499.0
Smso17g00152 ACH,SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.112 1.92e-126 353.0
Smso17g00264 ACH,SST,WGDA 14 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 90.833 1.02e-78 226.0
Smso17g00266 ACH,SST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 1.43e-107 303.0
Smso17g00362 ACH,SST,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 1.78e-99 280.0
Smso17g00446 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.211 1.68e-82 236.0
Smso17g00488 ACH,SST 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 2.40e-145 403.0
Smso17g00620 ACH,SST,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 2.67e-92 263.0
Smso17g00768 ACH,SST 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 89.431 2.53e-79 228.0
Smso17g00779 ACH,SST 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.232 7.89e-146 409.0
Smso17g00805 SST 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 78.261 1.24e-31 106.0
Smso17g01132 ACH 45 154 Cytoplasmic Ribosomal Protein gene family AT2G39460 45.217 2.91e-23 89.4
Smso17g01445 ACH 1 139 Cytoplasmic Ribosomal Protein gene family AT5G61170 85.612 3.89e-90 256.0
Smso17g01488 ACH 21 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 64.912 1.69e-77 227.0
Smso17g01575 ACH,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.286 1.31e-117 330.0
Smso17g01628 ACH 1 64 Cytoplasmic Ribosomal Protein gene family AT3G62250 44.776 1.18e-06 46.2
Smso17g01641 ACH 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 58.0 2.92e-93 274.0
Smso17g01771 . 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 74.825 6.79e-76 221.0
Smso17g02005 . 105 206 Cytoplasmic Ribosomal Protein gene family AT2G27530 29.808 8.46e-07 47.8
Smso17g02147 . 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 82.517 2.82e-89 254.0
Smso17g02155 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 39.437 4.10e-08 52.0
Smso17g02240 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 87.963 9.96e-54 161.0
Smso17g02360 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 1.08e-80 232.0
Smso17g02399 . 76 123 Cytoplasmic Ribosomal Protein gene family AT5G27850 77.083 7.28e-19 73.9
Smso17g02503 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 87.5 4.88e-71 206.0
Smso17g02515 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 64.655 6.87e-46 142.0
Smso17g02624 . 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 5.42e-86 248.0
Smso17g02634 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 2.15e-58 174.0
Smso17g02644 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 81.41 3.39e-83 241.0
Smso17g02673 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 90.0 6.07e-40 128.0
Smso17g02912 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.381 2.00e-168 464.0
Smso17g03170 . 71 119 Cytoplasmic Ribosomal Protein gene family AT1G69620 73.469 1.02e-17 75.1
Smso17g03241 ACH,SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 80.531 6.62e-63 186.0
Smso17g03248 ACH,SST,WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 3.58e-50 150.0
Smso17g03421 ACH,SST,WGDA 25 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 75.0 1.61e-64 191.0
Smso16g00042 ACH,SST,WGDA 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.869 1.25e-153 429.0
Smso16g00246 ACH,SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.131 1.05e-63 191.0
Smso16g00329 ACH,SST 1 161 Cytoplasmic Ribosomal Protein gene family AT1G67430 88.199 3.26e-103 291.0
Smso16g00440 ACH,SST,WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 1.98e-49 149.0
Smso16g00446 ACH,SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 80.531 1.29e-62 186.0
Smso16g00624 . 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 90.845 4.09e-90 256.0
Smso16g00939 SST 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso16g01392 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 89.937 1.28e-94 269.0
Smso16g01654 ACH,SST,WGDA 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 85.062 6.37e-154 426.0
Smso16g01689 ACH,SST,WGDA 21 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 46.667 5.45e-31 107.0
Smso16g01866 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 75.524 2.32e-76 222.0
Smso16g01899 SST 87 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 33.846 1.11e-07 45.4
Smso16g01928 SST,WGDA 12 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.927 4.21e-148 420.0
Smso16g02107 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso16g02228 SST,WGDA 127 204 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.769 2.97e-06 44.7
Smso16g02314 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT2G44860 70.625 1.99e-79 231.0
Smso16g02374 ACH,SST,WGDA 85 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 34.722 1.31e-07 46.2
Smso15g00009 . 66 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 92.053 1.68e-85 248.0
Smso15g00574 . 13 78 Cytoplasmic Ribosomal Protein gene family AT3G52590 93.939 9.91e-40 129.0
Smso15g00881 WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 1.02e-06 42.7
Smso15g00892 WGDA 20 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 34.862 1.04e-09 53.5
Smso15g00939 WGDA 19 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 79.639 0.0 626.0
Smso15g01351 WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 81.818 6.55e-89 253.0
Smso15g01363 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.028 1.29e-07 50.4
Smso15g01536 ACH 60 154 Cytoplasmic Ribosomal Protein gene family AT2G39460 50.526 8.91e-24 90.9
Smso15g01846 ACH 127 199 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.137 3.35e-06 43.5
Smso15g01876 ACH,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 83.916 3.56e-90 256.0
Smso15g02018 ACH,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.286 3.64e-119 335.0
Smso15g02071 ACH,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 4.08e-07 47.8
Smso15g02088 ACH,WGDA 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 58.8 4.67e-93 273.0
Smso15g02278 . 1 25 Cytoplasmic Ribosomal Protein gene family AT4G33865 64.0 2.02e-07 42.0
Smso14g00076 ACH 1 189 Cytoplasmic Ribosomal Protein gene family AT2G31610 71.429 3.74e-90 261.0
Smso14g00121 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 1.17e-70 205.0
Smso14g00138 ACH 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 85.714 3.38e-73 214.0
Smso14g00223 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.5 1.19e-178 494.0
Smso14g00444 . 4 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 85.714 2.65e-49 150.0
Smso14g00475 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 82.222 2.36e-81 235.0
Smso14g00594 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 90.196 6.96e-126 352.0
Smso14g00637 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 64.655 4.77e-44 137.0
Smso14g00651 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 87.5 5.33e-71 205.0
Smso14g00744 ACH 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 1.88e-86 250.0
Smso14g00781 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 3.08e-58 174.0
Smso14g00794 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 1.32e-83 243.0
Smso14g01085 SST,WGDA 4 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 81.141 0.0 670.0
Smso14g01398 . 1 63 Cytoplasmic Ribosomal Protein gene family AT5G64140 90.625 4.14e-35 113.0
Smso14g01472 . 59 96 Cytoplasmic Ribosomal Protein gene family AT5G02960 86.842 5.89e-17 69.7
Smso14g01497 . 5 80 Cytoplasmic Ribosomal Protein gene family AT5G28060 73.077 5.66e-38 123.0
Smso14g01663 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT3G02080 81.119 2.12e-87 249.0
Smso14g01720 . 56 100 Cytoplasmic Ribosomal Protein gene family AT4G34670 73.913 3.77e-13 64.7
Smso14g02009 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.795 2.93e-83 239.0
Smso14g02028 SST 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 85.56 1.18e-176 489.0
Smso14g02126 SST 9 211 Cytoplasmic Ribosomal Protein gene family AT2G27530 25.714 1.01e-06 47.8
Smso14g02132 . 61 162 Cytoplasmic Ribosomal Protein gene family AT4G34670 82.353 2.75e-59 181.0
Smso14g02386 ACH 109 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 91.216 9.09e-101 288.0
Smso14g02430 ACH,SST,WGDA 29 140 Cytoplasmic Ribosomal Protein gene family AT5G61170 75.893 2.20e-59 177.0
Smso14g02471 . 32 113 Cytoplasmic Ribosomal Protein gene family AT1G26880 87.805 7.60e-42 146.0
Smso14g02497 ACH,SST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 79.058 5.61e-113 319.0
Smso14g02570 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 83.562 1.27e-89 259.0
Smso14g02626 ACH,SST,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.857 1.75e-120 335.0
Smso14g02693 . 195 233 Cytoplasmic Ribosomal Protein gene family AT1G58983 84.615 4.03e-14 68.2
Smso14g02727 ACH,SST,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 1.54e-07 48.5
Smso14g02748 ACH,SST 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 74.59 7.64e-66 195.0
Smso14g02751 ACH,WGDA 1 199 Cytoplasmic Ribosomal Protein gene family AT1G80750 56.436 1.46e-69 213.0
Smso14g02913 . 118 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 83.178 4.89e-60 184.0
Smso14g02914 . 13 74 Cytoplasmic Ribosomal Protein gene family AT2G31610 82.258 4.89e-28 100.0
Smso13g00209 WGDA 21 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 46.043 3.41e-34 115.0
Smso13g00557 . 120 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 85.315 3.75e-91 265.0
Smso13g00565 SST 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.55 0.0 497.0
Smso13g00568 SST 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.55 0.0 497.0
Smso13g00746 ACH,SST,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 1.26e-92 262.0
Smso13g00757 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso13g00782 ACH,SST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 1.13e-146 410.0
Smso13g00879 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 2.18e-137 381.0
Smso13g00894 ACH,SST,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 85.821 4.94e-80 230.0
Smso13g01065 SST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.964 3.22e-151 421.0
Smso13g01143 SST,WGDA 15 132 Cytoplasmic Ribosomal Protein gene family AT4G18730 26.562 2.12e-06 45.4
Smso13g01174 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso13g01212 SST 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.526 2.77e-37 124.0
Smso13g01339 ACH,SST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.889 9.73e-10 55.5
Smso13g01394 SST 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 1.09e-119 336.0
Smso12g00166 ACH,SST,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 3.43e-122 353.0
Smso12g00423 ACH,SST,WGDA 38 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 93.162 1.55e-67 198.0
Smso12g00428 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 8.20e-72 208.0
Smso12g00500 SST 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 2.35e-92 263.0
Smso12g00557 SST,WGDA 2 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 79.104 6.65e-79 227.0
Smso12g00595 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso12g00604 SST 1 140 Cytoplasmic Ribosomal Protein gene family AT5G04800 81.119 3.19e-77 224.0
Smso12g00695 ACH,SST,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 1.70e-94 288.0
Smso12g00871 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.544 5.05e-34 112.0
Smso12g00880 ACH,SST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso12g01237 ACH,SST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.795 3.35e-82 236.0
Smso12g01373 SST,WGDA 5 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.818 3.63e-07 47.8
Smso12g01555 SST,WGDA 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 91.566 6.20e-167 459.0
Smso12g01564 SST 33 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 84.492 0.0 647.0
Smso12g01565 SST 19 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 82.99 0.0 654.0
Smso12g01755 . 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 100.0 2.33e-50 155.0
Smso12g01827 ACH,SST 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 9.31e-101 286.0
Smso12g02741 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 2.28e-48 156.0
Smso12g02803 SST 1 74 Cytoplasmic Ribosomal Protein gene family AT3G62250 40.0 8.35e-10 56.6
Smso12g03094 SST,WGDA 61 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 87.402 5.60e-83 240.0
Smso12g03100 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Smso12g03546 SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso12g03600 WGDA 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 4.36e-53 177.0
Smso12g03709 SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.053 7.70e-101 284.0
Smso12g03767 ACH,SST,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.974 4.09e-126 355.0
Smso12g03831 ACH,SST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso12g04048 . 118 208 Cytoplasmic Ribosomal Protein gene family AT2G31610 83.516 3.14e-53 166.0
Smso12g04096 SST,WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 6.27e-06 40.8
Smso12g04102 . 302 348 Cytoplasmic Ribosomal Protein gene family AT3G09630 59.574 3.46e-07 45.1
Smso11g00115 WGDA 20 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 33.945 3.87e-10 53.5
Smso11g00147 SST,WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 3.98e-06 41.2
Smso11g01229 ACH,SST 1 126 Cytoplasmic Ribosomal Protein gene family AT1G09690 80.159 4.71e-72 212.0
Smso11g01306 . 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 100.0 2.68e-50 155.0
Smso11g01475 SST 3 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 82.673 0.0 679.0
Smso11g01488 SST,WGDA 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 5.32e-166 457.0
Smso11g01671 SST,WGDA 5 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.818 6.04e-07 47.0
Smso11g01801 ACH,SST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 81.457 6.38e-84 241.0
Smso11g02194 ACH,SST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso11g02201 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.544 1.74e-29 111.0
Smso11g02485 SST 1 140 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.517 5.95e-78 226.0
Smso11g02495 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso11g02595 SST 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 4.28e-92 264.0
Smso11g02674 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 8.49e-73 213.0
Smso11g02680 ACH,SST,WGDA 85 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 98.571 5.13e-43 134.0
Smso11g02956 ACH,SST,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 2.96e-121 353.0
Smso10g00103 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 54.93 2.36e-12 58.9
Smso10g00215 ACH,SST 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 93.377 8.03e-102 286.0
Smso10g00359 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso10g00440 ACH,SST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 2.72e-120 335.0
Smso10g00675 ACH,SST 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.762 3.82e-126 353.0
Smso10g00678 ACH,SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.559 1.62e-120 337.0
Smso10g00687 ACH,SST,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 85.714 2.26e-62 185.0
Smso10g00761 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 2.23e-84 242.0
Smso10g00763 ACH,SST,WGDA 30 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.935 1.43e-86 247.0
Smso10g00840 ACH,SST,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 82.836 6.17e-77 222.0
Smso10g00893 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.835 1.12e-137 382.0
Smso10g00928 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 86.466 7.65e-84 241.0
Smso10g00935 . 1 62 Cytoplasmic Ribosomal Protein gene family AT5G56670 95.161 1.18e-29 101.0
Smso10g00940 ACH,SST,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 81.667 6.25e-69 203.0
Smso10g00964 ACH 85 139 Cytoplasmic Ribosomal Protein gene family AT1G29970 40.351 4.33e-07 44.7
Smso10g01108 ACH,SST,WGDA 1 121 Cytoplasmic Ribosomal Protein gene family AT3G47370 93.388 2.23e-81 234.0
Smso10g01157 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 1.31e-91 259.0
Smso10g01208 ACH,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.923 4.70e-91 258.0
Smso10g01659 . 1 67 Cytoplasmic Ribosomal Protein gene family AT4G10450 71.642 2.09e-29 103.0
Smso10g01789 . 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 81.849 1.07e-180 501.0
Smso10g01858 . 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 91.803 7.44e-77 228.0
Smso10g02220 ACH,SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 80.531 1.61e-62 185.0
Smso10g02228 ACH,SST,WGDA 10 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 84.722 5.67e-45 137.0
Smso10g02296 ACH,SST,WGDA 1 172 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.116 1.53e-117 328.0
Smso10g02364 ACH,SST,WGDA 25 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.333 2.97e-64 190.0
Smso10g02539 ACH,SST 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.072 1.55e-152 427.0
Smso10g02595 ACH,SST,WGDA 38 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 30.0 5.36e-08 47.4
Smso10g02644 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT2G44860 69.277 6.01e-79 229.0
Smso10g02741 SST,WGDA 127 204 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.769 1.98e-06 43.5
Smso10g02868 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 7.53e-70 203.0
Smso10g03065 ACH,SST,WGDA 12 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 83.333 3.56e-148 418.0
Smso10g03101 SST 87 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 33.846 2.53e-08 48.9
Smso10g03134 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 73.427 1.28e-73 215.0
Smso10g03296 ACH,SST,WGDA 6 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 40.719 1.84e-30 106.0
Smso10g03327 ACH,SST,WGDA 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 85.477 7.14e-154 426.0
Smso10g03541 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.679 1.28e-95 271.0
Smso10g03806 . 11 54 Cytoplasmic Ribosomal Protein gene family AT3G53870 84.091 8.65e-20 78.6
Smso10g03850 SST 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 94.444 8.83e-128 355.0
Smso9g00072 SST,WGDA 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 2.35e-92 263.0
Smso9g00073 SST 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 5.52e-92 261.0
Smso9g00199 WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.26 1.65e-162 451.0
Smso9g00401 ACH,SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 2.16e-117 330.0
Smso9g00497 . 1 78 Cytoplasmic Ribosomal Protein gene family AT3G52590 97.436 8.37e-50 157.0
Smso9g00537 SST,WGDA 21 119 Cytoplasmic Ribosomal Protein gene family AT3G47370 31.0 1.08e-07 47.0
Smso9g00728 ACH,SST,WGDA 7 242 Cytoplasmic Ribosomal Protein gene family AT2G01250 85.593 8.04e-151 418.0
Smso9g00755 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 89.815 1.09e-53 164.0
Smso9g00928 ACH,SST,WGDA 21 180 Cytoplasmic Ribosomal Protein gene family AT3G09200 23.636 1.50e-09 55.1
Smso9g01284 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 1.11e-69 204.0
Smso8g00069 ACH,SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.55 0.0 497.0
Smso8g00162 ACH,SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.645 2.44e-126 353.0
Smso8g00202 ACH,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 84.127 3.01e-62 187.0
Smso8g00268 . 1 47 Cytoplasmic Ribosomal Protein gene family AT5G64140 87.5 2.52e-23 82.4
Smso8g00294 ACH,SST,WGDA 14 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 90.833 1.02e-78 226.0
Smso8g00296 ACH,SST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso8g00386 ACH,SST,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 1.19e-99 281.0
Smso8g00471 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.962 1.02e-83 239.0
Smso8g00517 ACH,SST 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 3.94e-145 403.0
Smso8g00668 ACH,SST,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 1.09e-92 263.0
Smso8g00819 ACH,SST 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 90.244 2.97e-80 230.0
Smso8g00833 ACH,SST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 1.04e-145 410.0
Smso8g00868 SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 78.261 2.94e-30 106.0
Smso8g00882 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
Smso8g01208 ACH,SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 74.59 8.14e-65 194.0
Smso8g01368 SST,WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 7.79e-50 151.0
Smso8g01374 SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 80.531 6.62e-63 186.0
Smso8g01654 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 85.603 1.64e-166 459.0
Smso8g01937 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso8g01938 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso8g02089 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.0 1.87e-80 231.0
Smso8g02225 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 87.5 4.88e-71 206.0
Smso8g02258 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 66.379 7.74e-45 139.0
Smso8g02365 . 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 9.59e-87 250.0
Smso8g02401 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 80.769 1.53e-81 237.0
Smso8g02451 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 87.879 1.08e-57 175.0
Smso8g02641 SST,WGDA 3 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 30.882 8.18e-08 49.7
Smso8g02760 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 81.457 4.25e-84 241.0
Smso8g03115 ACH,SST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.364 2.50e-85 246.0
Smso8g03181 ACH,SST,WGDA 1 132 Cytoplasmic Ribosomal Protein gene family AT4G16720 90.909 2.76e-73 220.0
Smso8g03306 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 1.49e-72 211.0
Smso8g03311 ACH,SST,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 8.33e-73 213.0
Smso8g03389 ACH,SST 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 90.179 1.87e-74 216.0
Smso8g03524 SST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 1.16e-80 232.0
Smso8g03556 ACH,SST,WGDA 2 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 87.85 4.79e-50 156.0
Smso8g03667 ACH,SST,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 1.13e-92 287.0
Smso8g03822 ACH,SST 1 166 Cytoplasmic Ribosomal Protein gene family AT5G60670 90.964 7.45e-109 306.0
Smso7g00467 SST 85 133 Cytoplasmic Ribosomal Protein gene family AT5G63070 44.898 6.50e-10 52.8
Smso7g00597 ACH 1 57 Cytoplasmic Ribosomal Protein gene family AT3G52590 33.333 2.95e-06 44.7
Smso7g00774 ACH,SST 19 213 Cytoplasmic Ribosomal Protein gene family AT3G11250 20.0 1.18e-08 52.8
Smso7g00824 SST 1 387 Cytoplasmic Ribosomal Protein gene family AT1G61580 87.597 0.0 707.0
Smso7g00825 SST 29 387 Cytoplasmic Ribosomal Protein gene family AT1G61580 85.794 0.0 640.0
Smso7g00942 SST 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 85.185 2.49e-50 151.0
Smso7g01954 . 1 290 Cytoplasmic Ribosomal Protein gene family AT2G40010 75.172 6.03e-161 450.0
Smso7g02127 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.623 5.25e-80 231.0
Smso6g00055 ACH,SST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 2.22e-08 50.8
Smso6g00182 ACH,SST,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Smso6g00281 . 61 117 Cytoplasmic Ribosomal Protein gene family AT4G34670 82.456 5.53e-30 104.0
Smso6g00309 SST,WGDA 44 237 Cytoplasmic Ribosomal Protein gene family AT2G31610 85.714 4.17e-120 338.0
Smso6g00311 SST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.964 3.82e-152 424.0
Smso6g00492 SST,WGDA 8 250 Cytoplasmic Ribosomal Protein gene family AT2G31610 76.639 8.87e-127 357.0
Smso6g00515 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Smso6g00802 ACH,SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 92.754 7.19e-43 131.0
Smso6g00889 ACH,SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso6g00899 ACH,SST 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.023 7.36e-163 453.0
Smso6g01090 ACH,SST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.278 2.61e-10 57.4
Smso6g01411 SST 50 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 30.172 1.10e-07 48.9
Smso6g01522 . 14 237 Cytoplasmic Ribosomal Protein gene family AT2G31610 75.664 5.58e-119 338.0
Smso6g01604 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 58.784 2.20e-48 149.0
Smso6g01620 ACH,SST,WGDA 48 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 77.778 2.28e-79 247.0
Smso6g02037 . 89 122 Cytoplasmic Ribosomal Protein gene family AT3G02560 64.706 1.17e-09 52.4
Smso6g02456 . 4 163 Cytoplasmic Ribosomal Protein gene family AT1G18540 81.988 1.49e-91 267.0
Smso5g00044 SST,WGDA 38 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 29.412 9.23e-09 49.3
Smso5g00103 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT2G44860 70.807 5.10e-79 229.0
Smso5g00189 SST,WGDA 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 3.10e-06 43.1
Smso5g00284 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso5g00468 ACH,SST,WGDA 12 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.661 6.42e-149 419.0
Smso5g00515 SST,WGDA 35 143 Cytoplasmic Ribosomal Protein gene family AT2G19730 66.972 1.61e-42 137.0
Smso5g00542 . 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 86.316 9.76e-53 176.0
Smso5g00655 SST,WGDA 6 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 45.27 5.29e-34 114.0
Smso5g00676 ACH,SST,WGDA 83 242 Cytoplasmic Ribosomal Protein gene family AT2G44120 91.25 5.01e-108 306.0
Smso5g00685 SST 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 90.647 1.15e-90 264.0
Smso5g00727 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 90.741 3.58e-48 164.0
Smso5g00896 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.679 1.81e-95 271.0
Smso5g01379 WGDA 1 176 Cytoplasmic Ribosomal Protein gene family AT4G25740 75.138 1.86e-84 245.0
Smso5g01456 ACH,WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT4G16720 91.406 8.87e-72 213.0
Smso5g01582 ACH,SST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.071 4.58e-75 217.0
Smso5g02273 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 93.023 7.72e-59 172.0
Smso5g02370 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Smso4g00025 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 87.963 1.92e-53 160.0
Smso4g00089 . 82 148 Cytoplasmic Ribosomal Protein gene family AT5G58420 70.149 1.09e-28 102.0
Smso4g00109 . 33 77 Cytoplasmic Ribosomal Protein gene family AT3G09200 51.111 2.47e-09 52.0
Smso4g00530 . 1 220 Cytoplasmic Ribosomal Protein gene family AT1G66580 85.455 3.53e-144 399.0
Smso4g00538 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 7.42e-77 223.0
Smso4g00550 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 9.21e-59 172.0
Smso4g00610 ACH,SST 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.96 8.01e-120 334.0
Smso4g00651 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 84.932 2.82e-91 259.0
Smso4g00684 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Smso4g00864 ACH,SST 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 87.705 1.34e-71 208.0
Smso4g00879 ACH,SST 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 7.88e-75 219.0
Smso4g01050 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 6.95e-119 355.0
Smso4g01119 ACH,SST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.275 1.21e-86 249.0
Smso4g01159 ACH,SST,WGDA 1 176 Cytoplasmic Ribosomal Protein gene family AT4G25740 79.121 2.47e-83 243.0
Smso4g01285 . 1 141 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.454 4.06e-99 281.0
Smso4g01341 ACH,SST,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Smso4g01342 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Smso4g01454 ACH 1 105 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.193 5.54e-08 49.3
Smso4g01599 ACH,SST 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 1.10e-119 334.0
Smso4g01698 . 1 102 Cytoplasmic Ribosomal Protein gene family AT5G18380 55.882 9.28e-30 100.0
Smso4g01709 ACH,SST,WGDA 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 2.96e-58 173.0
Smso4g01755 ACH,SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso4g01762 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.0 6.56e-38 123.0
Smso4g01790 ACH,SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 3.46e-101 285.0
Smso4g01818 ACH,SST,WGDA 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 83.495 2.10e-109 311.0
Smso4g01839 ACH,SST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso4g02247 ACH,SST,WGDA 1 260 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.231 1.22e-180 495.0
Smso4g02341 SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.568 1.27e-122 349.0
Smso4g02371 ACH,SST 75 186 Cytoplasmic Ribosomal Protein gene family AT3G05590 87.5 1.45e-71 210.0
Smso4g02492 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 3.61e-85 244.0
Smso4g02523 . 138 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 66.667 3.55e-31 108.0
Smso4g02524 . 13 100 Cytoplasmic Ribosomal Protein gene family AT2G31610 89.773 1.51e-52 164.0
Smso4g02689 WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 2.54e-98 280.0
Smso4g02885 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT5G59850 91.429 5.84e-68 201.0
Smso4g03081 SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT4G25890 76.812 2.80e-31 105.0
Smso4g03092 SST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 5.89e-146 409.0
Smso4g03306 ACH,SST,WGDA 127 195 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.435 6.68e-06 42.7
Smso4g03312 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.381 3.13e-166 458.0
Smso3g00074 SST 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 7.40e-166 456.0
Smso3g00083 SST 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 39.437 5.07e-09 53.9
Smso3g00132 SST 53 386 Cytoplasmic Ribosomal Protein gene family AT1G43170 88.623 0.0 611.0
Smso3g00240 ACH 1 61 Cytoplasmic Ribosomal Protein gene family AT3G52590 34.426 2.07e-06 45.4
Smso3g00279 ACH,SST 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 84.541 3.39e-126 354.0
Smso3g00348 ACH,SST 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.86 0.0 496.0
Smso3g00397 ACH,SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 1.56e-64 191.0
Smso3g00534 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G23290 87.671 1.26e-94 270.0
Smso3g00625 . 1 115 Cytoplasmic Ribosomal Protein gene family AT1G26880 93.913 1.13e-75 218.0
Smso3g00760 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.938 8.45e-172 473.0
Smso3g01352 SST 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.928 2.53e-91 265.0
Smso3g01525 SST 1 193 Cytoplasmic Ribosomal Protein gene family AT1G33140 82.902 7.63e-118 330.0
Smso3g01594 . 1 111 Cytoplasmic Ribosomal Protein gene family AT3G52590 72.321 1.05e-46 145.0
Smso3g01607 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G04400 90.141 7.78e-42 131.0
Smso3g01800 . 116 151 Cytoplasmic Ribosomal Protein gene family AT4G09800 61.111 8.49e-08 46.2
Smso3g01853 SST,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 1.49e-58 172.0
Smso3g02224 SST 105 206 Cytoplasmic Ribosomal Protein gene family AT2G27530 29.808 4.60e-06 45.1
Smso3g02451 SST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.482 1.10e-76 224.0
Smso3g02515 ACH,SST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 1.03e-101 288.0
Smso3g02543 ACH,SST 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 6.25e-125 351.0
Smso3g02580 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.421 2.62e-33 113.0
Smso3g02643 ACH,SST 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.759 1.42e-108 305.0
Smso2g00259 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.696 2.32e-32 109.0
Smso2g00276 . 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 9.30e-120 352.0
Smso2g00312 ACH,SST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 2.38e-101 289.0
Smso2g00371 SST,WGDA 1 137 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.143 1.61e-77 225.0
Smso2g00389 SST 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Smso2g00525 ACH,SST 3 82 Cytoplasmic Ribosomal Protein gene family AT3G06680 65.0 5.26e-33 107.0
Smso2g00603 ACH,SST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.5 8.03e-08 50.1
Smso2g00690 ACH,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 5.77e-58 171.0
Smso2g00734 SST 1 129 Cytoplasmic Ribosomal Protein gene family AT4G29430 74.419 2.24e-74 215.0
Smso2g00737 SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 1.15e-115 331.0
Smso2g00845 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 9.86e-46 156.0
Smso2g00904 . 96 251 Cytoplasmic Ribosomal Protein gene family AT2G41840 29.091 1.17e-14 70.9
Smso2g01172 SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.44 9.76e-112 315.0
Smso2g01465 ACH,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.29e-127 353.0
Smso2g01594 SST 2 151 Cytoplasmic Ribosomal Protein gene family AT1G29970 46.405 2.96e-33 113.0
Smso2g01595 SST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 7.07e-120 334.0
Smso2g01736 SST,WGDA 1 234 Cytoplasmic Ribosomal Protein gene family AT2G31610 88.186 8.87e-153 423.0
Smso2g01737 SST,WGDA 44 237 Cytoplasmic Ribosomal Protein gene family AT2G31610 85.204 2.65e-120 339.0
Smso2g01975 WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.84e-126 352.0
Smso2g02164 . 4 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 43.056 3.63e-09 53.9
Smso2g02178 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 5.28e-08 49.7
Smso2g02242 . 4 64 Cytoplasmic Ribosomal Protein gene family AT5G64140 93.548 8.03e-35 112.0
Smso2g02253 . 27 68 Cytoplasmic Ribosomal Protein gene family AT5G09500 78.571 1.10e-15 69.7
Smso2g02254 . 4 68 Cytoplasmic Ribosomal Protein gene family AT5G09500 69.231 4.92e-25 90.9
Smso2g02576 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 88.327 1.30e-171 471.0
Smso2g02719 SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.77 3.62e-63 193.0
Smso1g00059 SST,WGDA 1 82 Cytoplasmic Ribosomal Protein gene family AT3G52590 41.463 6.31e-11 58.9
Smso1g00065 SST,WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.105 4.11e-117 328.0
Smso1g00102 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 3.80e-48 156.0
Smso1g00131 ACH,SST,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 8.66e-58 171.0
Smso1g00218 . 61 162 Cytoplasmic Ribosomal Protein gene family AT4G34670 83.333 4.60e-61 186.0
Smso1g00339 SST 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 49.65 1.13e-33 111.0
Smso1g00400 ACH,WGDA 91 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 91.453 1.72e-76 223.0
Smso1g00424 ACH,SST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 88.889 8.33e-129 360.0
Smso1g00531 ACH,SST,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT5G60670 90.361 1.63e-108 307.0
Smso1g00797 SST 99 216 Cytoplasmic Ribosomal Protein gene family AT3G51190 41.525 4.08e-23 91.7
Smso1g00956 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.624 5.52e-118 344.0
Smso1g01225 SST,WGDA 7 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 83.186 3.62e-67 199.0
Smso1g01608 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso1g02105 SST,WGDA 7 242 Cytoplasmic Ribosomal Protein gene family AT2G01250 85.169 3.55e-150 417.0
Smso1g02210 SST,WGDA 13 126 Cytoplasmic Ribosomal Protein gene family AT3G07110 31.061 7.20e-07 46.6
Smso1g02311 ACH,SST,WGDA 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.86 0.0 496.0
Smso1g02385 ACH,SST,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.507 1.19e-126 357.0
Smso1g02391 SST,WGDA 21 119 Cytoplasmic Ribosomal Protein gene family AT3G47370 31.0 2.83e-07 45.8
Smso1g02579 SST,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G49010 86.429 2.44e-83 244.0
Smso1g02581 ACH,SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 71.204 2.70e-92 266.0
Smso1g02710 ACH 1 62 Cytoplasmic Ribosomal Protein gene family AT3G59540 95.161 1.59e-38 122.0
Smso1g02962 SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.641 7.13e-163 451.0
Smso1g02988 WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 7.01e-72 208.0
Smso1g03059 WGDA 81 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 87.342 9.23e-45 139.0
Smso1g03060 . 1 22 Cytoplasmic Ribosomal Protein gene family AT5G23740 90.909 2.36e-06 40.8
Smso1g03144 SST,WGDA 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 86.184 2.62e-92 262.0
Smso1g03604 ACH,SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.645 1.53e-123 349.0
Smso1g03611 ACH,SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 87.097 2.62e-121 338.0
Smso1g03620 . 90 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 85.714 8.66e-17 67.4
Smso1g03724 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.806 1.06e-83 242.0
Smso1g03809 ACH,SST,WGDA 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.733 8.23e-77 222.0
Smso1g03822 ACH 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Smso1g03867 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 3.49e-137 380.0
Smso1g03936 ACH 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 81.507 3.30e-180 497.0
Smso1g03953 ACH 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 4.34e-145 401.0
Smso1g03990 SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 81.416 2.07e-63 189.0
Smso1g04112 ACH,SST,WGDA 14 121 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.222 4.99e-76 219.0
Smso1g04204 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.623 1.32e-80 231.0