AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Smso20g01143 ATGGCTTTCACCATTGCTTCCACCTCCCACTCATCCCTCCCAACCAGGTCTTACACATTCGCCACGAAATCAGCTTGTGCTGAAAGAAGTAGTACTCCAAGGTACTTGTTCAGAAGCAGCCATGGACAGAAGCTCAAAGCAGCTAAAGAAGGAGTATCAAGTGTCTGTGAACCACTTCCTGCTGACAGACCATTATGGTTCCCGGGATCCTCACCTCCTGAATGGCTTGATGGCAGCCTCCCTGGAGATTTTGGCTTCGACCCACTCGGATTAGGTTCTGATCCAGAATTACTGAAATGGTTTGCCCAAGCTGAGTTGATGCACAGCAGATGGGCGATGCTTGCAGTTGCTGGTATTCTGATCCCAGAATGGCTCGAAAGTTTGGGCTTCATCGACAACTTCTCGTGGTTCGAAGCTGGCTCTAGAGAATACTTTGCTGACCCAACCACTTTATTCGTGGTGCAATTAGTCTTGATGGGTTGGGTGGAGGGTCGAAGATGGGCCGACATGATCAACCCAGGGTGCGTTGACATCGAGCCTAATCTCCCCAACAAGAAGAAACCAAAGCCCGATGTCGGGTACCCAGGTGGATTGTGGTTTGACCCGTTCATGTGGGGAAGAGGGTCTCCAGAACCGGTGATGGTTTTGAGGACCAAAGAAATAAAGAACGGGCGGCTAGCCATGCTGGCTTTTGCGGGTTTTGTGTTCCAAGCCATTTACACCGGGCAAAGCCCCCTTGAGAACCTATCGGCTCACCTTGCGGATCCTGGTCATGTCAACATTTTCTCGGCCTTCAACACCCAAATTCAATGA 813 50.55 MAFTIASTSHSSLPTRSYTFATKSACAERSSTPRYLFRSSHGQKLKAAKEGVSSVCEPLPADRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWLESLGFIDNFSWFEAGSREYFADPTTLFVVQLVLMGWVEGRRWADMINPGCVDIEPNLPNKKKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFAGFVFQAIYTGQSPLENLSAHLADPGHVNIFSAFNTQIQ 270
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Smso20g01143 270 Gene3D Chlorophyll a-b binding protein domain 73 258 - -
Smso20g01143 270 FunFam Chlorophyll a-b binding protein, chloroplastic 73 258 - -
Smso20g01143 270 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 19 263 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Smso20g01143 270 Pfam Chlorophyll A-B binding protein 72 239 IPR022796 -
Smso20g01143 270 SUPERFAMILY Chlorophyll a-b binding protein 62 265 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Smso20g01143 K08908 light-harvesting complex I chlorophyll a/b binding protein 2
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Smso Smso-Chr10:91795529 Smso20g01143 Smso-Chr20:20228668 dispersed
Smso Smso-Chr13:82760889 Smso20g01143 Smso-Chr20:20228668 dispersed
Smso Smso-Chr16:71788086 Smso20g01143 Smso-Chr20:20228668 dispersed
Smso Smso-Chr20:20228668 Smso6g00553 Smso-Chr6:6246462 dispersed
Smso Smso-Chr10:10512437 Smso20g01143 Smso-Chr20:20228668 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Smso29g00095 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.5 6.94e-168 463.0
Smso29g01202 . 3 143 Chloroplast and Mitochondria gene family AT1G07020 45.205 3.01e-23 87.4
Smso29g01331 ACH,SST 68 346 Chloroplast and Mitochondria gene family AT1G72820 60.932 3.60e-102 299.0
Smso29g01340 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 69.444 6.07e-35 111.0
Smso29g01389 . 42 323 Chloroplast and Mitochondria gene family AT2G30160 73.498 5.80e-148 416.0
Smso29g01455 . 11 258 Chloroplast and Mitochondria gene family AT5G15640 42.742 4.70e-58 186.0
Smso28g00160 SST,WGDA 51 405 Chloroplast and Mitochondria gene family AT2G28800 82.961 0.0 603.0
Smso28g00209 . 510 580 Chloroplast and Mitochondria gene family AT4G21490 40.789 2.11e-13 61.6
Smso28g00229 ACH,SST,WGDA 1 329 Chloroplast and Mitochondria gene family AT2G30160 70.909 1.95e-166 464.0
Smso28g00488 SST,WGDA 1 307 Chloroplast and Mitochondria gene family AT2G47490 75.974 1.12e-163 456.0
Smso28g00700 . 106 266 Chloroplast and Mitochondria gene family AT2G34430 89.441 2.71e-99 285.0
Smso28g00702 . 109 266 Chloroplast and Mitochondria gene family AT2G34430 89.873 1.14e-100 291.0
Smso27g00353 SST 33 354 Chloroplast and Mitochondria gene family AT5G54290 72.981 3.27e-147 419.0
Smso27g00433 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 70.3 0.0 533.0
Smso27g00604 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 4.97e-75 227.0
Smso26g00533 WGDA 24 330 Chloroplast and Mitochondria gene family AT4G21490 60.323 4.87e-117 348.0
Smso26g00668 . 34 252 Chloroplast and Mitochondria gene family AT3G61470 91.324 1.62e-148 414.0
Smso26g01241 ACH,SST,WGDA 47 548 Chloroplast and Mitochondria gene family AT2G18710 81.496 0.0 832.0
Smso26g01849 . 106 273 Chloroplast and Mitochondria gene family AT1G61520 90.476 2.80e-110 316.0
Smso26g02415 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.232 1.23e-143 400.0
Smso26g02748 ACH,SST,WGDA 33 327 Chloroplast and Mitochondria gene family AT1G25380 65.449 7.25e-140 399.0
Smso25g00801 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.679 2.80e-180 496.0
Smso25g00802 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 80.0 3.16e-156 433.0
Smso25g01300 SST,WGDA 11 309 Chloroplast and Mitochondria gene family AT2G17270 63.88 2.23e-148 417.0
Smso25g01367 SST,WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.842 2.23e-47 159.0
Smso25g01527 ACH,SST,WGDA 9 228 Chloroplast and Mitochondria gene family AT5G38630 71.818 7.51e-116 328.0
Smso25g01887 SST 37 310 Chloroplast and Mitochondria gene family AT1G25380 25.733 1.19e-27 109.0
Smso25g02335 WGDA 1 374 Chloroplast and Mitochondria gene family AT5G14040 77.005 0.0 571.0
Smso24g00355 SST,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.52 7.87e-166 464.0
Smso24g00472 SST,WGDA 3 187 Chloroplast and Mitochondria gene family AT1G17530 62.162 4.21e-70 209.0
Smso24g00874 SST,WGDA 110 257 Chloroplast and Mitochondria gene family AT1G15820 86.486 8.06e-92 266.0
Smso24g00992 . 45 271 Chloroplast and Mitochondria gene family AT4G03320 35.931 1.36e-41 144.0
Smso24g01596 ACH,SST 1 227 Chloroplast and Mitochondria gene family AT5G38630 65.198 3.33e-108 310.0
Smso24g02395 . 152 252 Chloroplast and Mitochondria gene family AT3G61470 96.04 1.05e-67 206.0
Smso24g02910 SST 128 236 Chloroplast and Mitochondria gene family AT1G26100 62.385 1.80e-33 114.0
Smso24g02911 SST 54 124 Chloroplast and Mitochondria gene family AT1G26100 70.27 5.76e-28 102.0
Smso23g00882 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 2.47e-171 472.0
Smso23g00883 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 1.01e-170 470.0
Smso23g00884 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 2.47e-171 472.0
Smso23g00885 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 9.93e-171 470.0
Smso23g01469 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.31e-122 348.0
Smso23g01470 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.27e-122 348.0
Smso22g01200 ACH,SST,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.993 0.0 515.0
Smso22g01429 SST 7 320 Chloroplast and Mitochondria gene family AT5G15640 74.204 3.42e-179 496.0
Smso22g01430 SST 7 320 Chloroplast and Mitochondria gene family AT5G15640 71.975 1.13e-174 485.0
Smso22g01928 . 38 251 Chloroplast and Mitochondria gene family AT3G61470 47.465 6.75e-62 194.0
Smso22g02342 ACH,SST 1 361 Chloroplast and Mitochondria gene family AT5G14040 70.36 0.0 505.0
Smso22g02590 SST 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.516 7.28e-175 488.0
Smso21g00270 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 61.607 1.16e-94 274.0
Smso21g00271 ACH,SST 4 214 Chloroplast and Mitochondria gene family AT4G25570 44.55 7.91e-63 194.0
Smso21g00394 ACH,SST,WGDA 61 206 Chloroplast and Mitochondria gene family AT1G25380 58.219 6.57e-52 166.0
Smso21g00661 ACH,SST 76 407 Chloroplast and Mitochondria gene family AT2G28800 63.559 2.49e-157 455.0
Smso21g00805 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 61.57 2.53e-93 271.0
Smso21g01471 ACH,WGDA 4 211 Chloroplast and Mitochondria gene family AT4G25570 43.269 7.62e-58 181.0
Smso21g01584 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 2.59e-171 471.0
Smso21g01585 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 8.09e-172 473.0
Smso21g02135 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 84.249 1.16e-164 458.0
Smso21g02136 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 84.615 1.50e-164 458.0
Smso20g00446 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.39e-171 472.0
Smso20g00447 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 86.692 1.97e-167 462.0
Smso20g01143 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 66.667 2.16e-101 294.0
Smso20g01560 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 71.646 1.15e-168 470.0
Smso19g00387 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 87.072 2.18e-168 464.0
Smso19g00543 ACH,SST,WGDA 4 177 Chloroplast and Mitochondria gene family AT4G25570 44.253 1.56e-50 161.0
Smso19g01381 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 81.716 6.88e-156 432.0
Smso19g01382 . 104 181 Chloroplast and Mitochondria gene family AT2G34420 89.744 9.66e-45 143.0
Smso19g01384 . 191 266 Chloroplast and Mitochondria gene family AT2G34430 85.526 4.86e-39 129.0
Smso18g00735 . 210 243 Chloroplast and Mitochondria gene family AT5G40810 88.235 1.26e-14 66.6
Smso18g01155 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 79.151 7.19e-148 412.0
Smso18g01536 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.811 0.0 499.0
Smso18g01539 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.811 0.0 496.0
Smso17g01266 . 32 280 Chloroplast and Mitochondria gene family AT4G10340 89.243 7.66e-148 413.0
Smso17g01268 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 85.409 1.25e-151 425.0
Smso17g01686 ACH 32 184 Chloroplast and Mitochondria gene family AT5G40810 81.529 2.65e-84 250.0
Smso17g02047 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.319 0.0 516.0
Smso17g02169 . 11 265 Chloroplast and Mitochondria gene family AT5G15640 64.0 2.58e-125 359.0
Smso17g02643 . 1 300 Chloroplast and Mitochondria gene family AT4G25700 65.506 1.38e-145 410.0
Smso17g03395 ACH,SST 2 364 Chloroplast and Mitochondria gene family AT5G14040 75.824 0.0 556.0
Smso16g00611 . 55 147 Chloroplast and Mitochondria gene family AT5G15640 60.638 2.36e-35 121.0
Smso16g00990 . 1 264 Chloroplast and Mitochondria gene family AT1G29930 76.136 2.25e-135 384.0
Smso16g00991 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 86.466 5.16e-168 463.0
Smso16g01000 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 87.97 6.15e-170 468.0
Smso16g01001 . 95 266 Chloroplast and Mitochondria gene family AT2G34430 79.651 6.32e-94 272.0
Smso16g01327 ACH,SST,WGDA 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.843 5.50e-151 420.0
Smso16g01896 SST,WGDA 5 187 Chloroplast and Mitochondria gene family AT1G17530 63.636 1.75e-72 215.0
Smso16g02002 SST,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.317 8.21e-169 472.0
Smso15g00161 . 79 286 Chloroplast and Mitochondria gene family AT1G25380 28.511 9.45e-10 56.6
Smso15g00565 . 134 168 Chloroplast and Mitochondria gene family AT2G30160 77.778 2.30e-12 60.5
Smso15g01235 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.993 0.0 513.0
Smso15g01706 . 32 280 Chloroplast and Mitochondria gene family AT4G10340 88.446 4.51e-148 416.0
Smso15g01707 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 84.342 1.24e-150 421.0
Smso15g02144 ACH 26 270 Chloroplast and Mitochondria gene family AT5G40810 76.613 4.16e-127 361.0
Smso14g00539 . 245 308 Chloroplast and Mitochondria gene family AT5G14040 71.875 2.98e-30 108.0
Smso14g01422 ACH,SST,WGDA 21 307 Chloroplast and Mitochondria gene family AT5G40810 88.502 5.73e-179 494.0
Smso14g01705 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 74.204 5.25e-179 496.0
Smso14g01706 SST 112 263 Chloroplast and Mitochondria gene family AT5G15640 73.684 7.00e-79 234.0
Smso14g01707 SST 7 61 Chloroplast and Mitochondria gene family AT5G15640 67.273 7.57e-22 85.1
Smso14g02253 . 38 254 Chloroplast and Mitochondria gene family AT3G61470 46.364 4.90e-61 192.0
Smso14g02457 . 35 255 Chloroplast and Mitochondria gene family AT3G61470 52.036 4.21e-75 227.0
Smso14g02695 ACH,SST 1 361 Chloroplast and Mitochondria gene family AT5G14040 70.36 0.0 508.0
Smso14g02958 SST 1 345 Chloroplast and Mitochondria gene family AT1G72820 70.255 3.74e-178 496.0
Smso13g00160 . 108 273 Chloroplast and Mitochondria gene family AT1G61520 92.169 7.40e-111 315.0
Smso13g00675 ACH,SST,WGDA 43 548 Chloroplast and Mitochondria gene family AT2G18710 80.664 0.0 829.0
Smso13g01023 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 91.441 2.10e-150 419.0
Smso12g00077 SST 1 239 Chloroplast and Mitochondria gene family AT4G25570 64.854 1.16e-110 316.0
Smso12g00898 SST,WGDA 2 373 Chloroplast and Mitochondria gene family AT5G14040 77.419 0.0 582.0
Smso12g00944 ACH,SST 1 307 Chloroplast and Mitochondria gene family AT5G40810 86.129 0.0 516.0
Smso12g01305 SST,WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.786 2.97e-48 162.0
Smso12g01578 SST 33 294 Chloroplast and Mitochondria gene family AT1G25380 29.123 4.27e-13 67.4
Smso12g02443 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.567 1.17e-171 473.0
Smso12g03333 ACH,SST,WGDA 4 211 Chloroplast and Mitochondria gene family AT4G25570 43.269 6.62e-54 171.0
Smso12g03958 . 112 151 Chloroplast and Mitochondria gene family AT5G15640 67.5 7.18e-14 63.2
Smso12g04148 . 31 245 Chloroplast and Mitochondria gene family AT1G76570 76.279 5.11e-124 353.0
Smso11g00016 . 25 325 Chloroplast and Mitochondria gene family AT1G76570 76.744 4.86e-178 493.0
Smso11g00456 . 71 149 Chloroplast and Mitochondria gene family AT5G15640 58.228 3.78e-25 93.6
Smso11g01462 SST 33 294 Chloroplast and Mitochondria gene family AT1G25380 29.474 4.39e-13 67.4
Smso11g01743 SST,WGDA 33 308 Chloroplast and Mitochondria gene family AT1G25380 35.088 3.41e-48 163.0
Smso11g01946 ACH,WGDA 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.982 2.35e-114 325.0
Smso11g02122 ACH,SST 1 307 Chloroplast and Mitochondria gene family AT5G40810 75.484 1.21e-152 430.0
Smso11g02176 ACH,SST,WGDA 5 373 Chloroplast and Mitochondria gene family AT5G14040 78.049 0.0 581.0
Smso11g03053 SST 1 239 Chloroplast and Mitochondria gene family AT4G25570 64.854 7.37e-111 316.0
Smso10g00391 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 5.26e-171 471.0
Smso10g00392 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 86.312 6.11e-167 460.0
Smso10g00985 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 67.317 2.12e-101 295.0
Smso10g01428 ACH,SST,WGDA 65 548 Chloroplast and Mitochondria gene family AT2G18710 83.058 0.0 819.0
Smso10g02975 . 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.029 2.81e-167 468.0
Smso10g02976 SST,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.029 2.81e-167 468.0
Smso10g03105 SST,WGDA 5 187 Chloroplast and Mitochondria gene family AT1G17530 64.706 9.14e-74 218.0
Smso10g03588 ACH,SST,WGDA 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.375 7.34e-153 426.0
Smso10g03822 . 75 266 Chloroplast and Mitochondria gene family AT2G34430 91.667 2.87e-128 360.0
Smso10g03930 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 84.982 1.17e-162 454.0
Smso8g00255 . 104 270 Chloroplast and Mitochondria gene family AT4G03320 41.279 3.90e-41 142.0
Smso8g01243 ACH,SST 1 364 Chloroplast and Mitochondria gene family AT5G14040 76.099 0.0 563.0
Smso8g02207 . 179 218 Chloroplast and Mitochondria gene family AT4G25700 75.0 9.98e-17 70.5
Smso8g02410 . 21 300 Chloroplast and Mitochondria gene family AT4G25700 68.166 3.77e-143 409.0
Smso8g02630 SST,WGDA 14 301 Chloroplast and Mitochondria gene family AT2G17270 63.889 3.58e-140 397.0
Smso8g02709 SST,WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.544 1.69e-47 160.0
Smso8g02892 ACH,SST,WGDA 1 228 Chloroplast and Mitochondria gene family AT5G38630 71.491 2.63e-119 337.0
Smso8g03413 SST 37 310 Chloroplast and Mitochondria gene family AT1G25380 26.623 3.77e-28 110.0
Smso7g00087 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.281 2.18e-169 468.0
Smso7g01336 SST 24 233 Chloroplast and Mitochondria gene family AT1G72820 63.333 5.44e-79 239.0
Smso7g01800 SST,WGDA 42 548 Chloroplast and Mitochondria gene family AT2G18710 80.117 0.0 830.0
Smso7g02258 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 84.982 1.41e-162 451.0
Smso6g00041 ACH,SST 1 236 Chloroplast and Mitochondria gene family AT1G26100 65.447 1.29e-96 280.0
Smso6g00553 . 32 254 Chloroplast and Mitochondria gene family AT3G61470 90.135 1.51e-149 416.0
Smso6g01441 ACH,SST 1 230 Chloroplast and Mitochondria gene family AT5G38630 63.913 1.60e-107 308.0
Smso5g00154 . 136 169 Chloroplast and Mitochondria gene family AT2G30160 74.286 8.74e-09 56.2
Smso5g00156 . 136 169 Chloroplast and Mitochondria gene family AT2G30160 74.286 8.74e-09 56.2
Smso5g00382 SST,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.098 3.17e-168 471.0
Smso5g00492 SST,WGDA 5 187 Chloroplast and Mitochondria gene family AT1G17530 61.957 1.02e-69 208.0
Smso5g00968 SST,WGDA 1 258 Chloroplast and Mitochondria gene family AT1G15820 81.008 9.41e-150 416.0
Smso5g01696 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.5 4.76e-144 401.0
Smso5g02110 ACH,SST,WGDA 33 327 Chloroplast and Mitochondria gene family AT1G25380 64.784 1.14e-139 399.0
Smso4g00242 ACH,SST 1 224 Chloroplast and Mitochondria gene family AT1G14730 61.607 2.61e-94 273.0
Smso4g00361 ACH,SST,WGDA 35 240 Chloroplast and Mitochondria gene family AT1G25380 58.173 9.98e-81 242.0
Smso4g00645 ACH,SST 76 407 Chloroplast and Mitochondria gene family AT2G28800 63.559 3.72e-156 452.0
Smso4g01596 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 2.27e-171 472.0
Smso4g01598 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.64 1.94e-172 474.0
Smso4g01911 WGDA 247 304 Chloroplast and Mitochondria gene family AT4G21490 72.414 3.54e-24 91.7
Smso4g02088 . 105 155 Chloroplast and Mitochondria gene family AT2G47490 61.538 5.42e-11 56.2
Smso4g02101 . 169 210 Chloroplast and Mitochondria gene family AT5G14040 61.905 2.23e-06 48.1
Smso4g02226 . 15 287 Chloroplast and Mitochondria gene family AT5G01530 83.883 2.99e-163 455.0
Smso3g00367 SST 37 354 Chloroplast and Mitochondria gene family AT5G54290 72.327 3.92e-145 412.0
Smso3g00642 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 56.219 2.13e-75 228.0
Smso3g02240 . 47 129 Chloroplast and Mitochondria gene family AT2G30160 59.036 6.55e-26 97.4
Smso2g00595 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.642 1.29e-34 132.0
Smso2g01635 . 106 266 Chloroplast and Mitochondria gene family AT2G34430 90.062 1.17e-102 293.0
Smso2g01636 . 106 266 Chloroplast and Mitochondria gene family AT2G34430 91.304 1.49e-104 298.0
Smso2g01637 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 8.61e-170 468.0
Smso2g01852 . 1 303 Chloroplast and Mitochondria gene family AT2G17270 66.337 1.35e-158 443.0
Smso2g01935 . 203 241 Chloroplast and Mitochondria gene family AT5G40810 76.923 9.03e-14 65.1
Smso2g02219 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 77.151 0.0 576.0
Smso2g02740 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 3.30e-123 350.0
Smso2g02741 . 3 265 Chloroplast and Mitochondria gene family AT2G05100 66.541 5.36e-117 346.0
Smso1g01115 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 4.16e-169 466.0
Smso1g02124 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.434 3.41e-179 491.0
Smso1g02127 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 89.434 2.22e-180 494.0
Smso1g02208 . 200 246 Chloroplast and Mitochondria gene family AT1G61520 61.702 2.29e-13 63.2
Smso1g03495 . 165 246 Chloroplast and Mitochondria gene family AT1G61520 37.647 3.20e-08 49.3
Smso1g03582 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 26.087 3.81e-29 114.0
Smso1g03601 SST,WGDA 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.299 4.04e-164 457.0
Smso1g03951 ACH 1 71 Chloroplast and Mitochondria gene family AT5G05370 61.972 3.16e-30 102.0
Smso1g04006 SST,WGDA 1 323 Chloroplast and Mitochondria gene family AT2G30160 70.988 3.32e-164 459.0
Smso1g04108 SST,WGDA 51 449 Chloroplast and Mitochondria gene family AT2G28800 77.667 0.0 603.0