AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Smso28g00483 ATGCAAGGACCAGCCTCCGCCGTCGTCATGGGTATCGATCTTGTTGCCGGTGGTAAGAGCAAGAGAACCAAAAGAACCGCCCCTAGATCCGACGATATCTACCTGAAACTCCTCGTCAAGCTTTACCGGTTTATGGTGAGGAGGACCGGAAGCAACTTCAATGCTGTGATACTGAAGAGGCTCTTCATGAGCAAAGTCAACAAGCCTCCGATCTCCCTATCTCGCCTGATTCGTTACATGTCCGGCAAGGACGATAAGATTGCTGTGGTTGTTGGAACAGTTACGGATGATGTTAGGGTTCATGAAATCCCTTGCTTGAAGGTGACTGCATTGAGGTTTACTGAGACGGCTAGGGCTAGGATTGAGAAGGCCGGTGGAGAGTGTTTGACTTTTGATCAGCTGGCTCTTCGAGCTCCTCTTGGACAGAACACTGTTCTTCTGAGAGGTCCAAAGAACTCCCGTGAAGCGGTGAAGCACTTTGGTAAGGCTCCTGGTGTACCACACAGTCACACCAAGCCTTATGTGAGATCAACGGGAAGGAAGTTTGAGAAGGCCAGAGGTAGAAGAAACAGCAGGGGATTTAGAAACTAA 591 49.58 MQGPASAVVMGIDLVAGGKSKRTKRTAPRSDDIYLKLLVKLYRFMVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIRYMSGKDDKIAVVVGTVTDDVRVHEIPCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRSTGRKFEKARGRRNSRGFRN 196
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Smso28g00483 196 SUPERFAMILY Ribosomal proteins L15p and L18e 30 148 IPR036227 -
Smso28g00483 196 PANTHER 60S RIBOSOMAL PROTEIN L18 10 196 IPR000039 GO:0003723(PANTHER)|GO:0003735(PANTHER)|GO:0003735(InterPro)|GO:0005840(InterPro)|GO:0006412(InterPro)|GO:0022625(PANTHER)
Smso28g00483 196 MobiDBLite consensus disorder prediction 160 196 - -
Smso28g00483 196 Gene3D - 10 196 - -
Smso28g00483 196 MobiDBLite consensus disorder prediction 182 196 - -
Smso28g00483 196 Pfam Ribosomal protein 60S L18 and 50S L18e 11 195 IPR021131 -
Smso28g00483 196 FunFam 60S ribosomal protein L18 10 196 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Smso28g00483 K02883 large subunit ribosomal protein L18e
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
141541 Smso10g00678 Smso28g00483
149499 Smso20g00786 Smso28g00483
151307 Smso21g02269 Smso28g00483
337985 Smso28g00483 Smso1g03611
357502 Smso1g03611 Smso28g00483
429045 Smso1g03611 Smso28g00483
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
4980516 Smso Smso26g00052 Smso-Chr26:520154 Smso28g00483 Smso-Chr28:13375333
4984966 Smso Smso28g00483 Smso-Chr28:13375333 Smso4g02371 Smso-Chr4:39222908
5027962 Smso Smso1g03611 Smso-Chr1:121449405 Smso28g00483 Smso-Chr28:13375333
5035782 Smso Smso10g00678 Smso-Chr10:7132266 Smso28g00483 Smso-Chr28:13375333
5077959 Smso Smso20g00786 Smso-Chr20:13705853 Smso28g00483 Smso-Chr28:13375333
5078007 Smso Smso20g01828 Smso-Chr20:61697138 Smso28g00483 Smso-Chr28:13375333
5080442 Smso Smso21g02269 Smso-Chr21:32401797 Smso28g00483 Smso-Chr28:13375333
5096033 Smso Smso28g00483 Smso-Chr28:13375333 Smso29g01597 Smso-Chr29:42991926
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
SmsoJAKNSE010000062g00021 . 26 136 Cytoplasmic Ribosomal Protein gene family AT3G04400 33.913 2.86e-14 67.0
SmsoJAKNSE010000056g00008 . 14 148 Cytoplasmic Ribosomal Protein gene family AT5G15200 29.787 1.33e-06 48.1
SmsoJAKNSE010000056g00013 . 106 148 Cytoplasmic Ribosomal Protein gene family AT5G39850 48.837 2.95e-06 44.3
SmsoJAKNSE010000045g00012 . 28 137 Cytoplasmic Ribosomal Protein gene family AT2G36160 35.455 1.34e-13 62.0
SmsoJAKNSE010000045g00015 . 26 136 Cytoplasmic Ribosomal Protein gene family AT3G04400 33.913 4.89e-16 67.8
SmsoJAKNSE010000045g00017 . 108 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 46.296 8.47e-21 83.2
SmsoJAKNSE010000045g00020 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
SmsoJAKNSE010000037g00119 . 84 161 Cytoplasmic Ribosomal Protein gene family AT2G47610 53.086 2.41e-16 70.5
SmsoJAKNSE010000037g00227 . 28 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 79.348 5.58e-48 147.0
SmsoJAKNSE010000034g00009 . 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.857 1.87e-119 336.0
SmsoJAKNSE010000034g00062 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 4.50e-07 47.4
SmsoJAKNSE010000034g00077 . 1 60 Cytoplasmic Ribosomal Protein gene family AT1G80750 53.968 3.09e-11 55.1
SmsoJAKNSE010000034g00204 . 1 143 Cytoplasmic Ribosomal Protein gene family AT2G19730 75.524 1.66e-73 215.0
Smso29g00064 ACH,WGDA 6 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 40.0 1.35e-31 108.0
Smso29g00314 WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.247 7.76e-90 256.0
Smso29g00619 SST 85 133 Cytoplasmic Ribosomal Protein gene family AT5G63070 42.857 2.86e-10 53.1
Smso29g00666 . 55 101 Cytoplasmic Ribosomal Protein gene family AT5G02960 78.723 2.84e-21 82.4
Smso29g00668 . 55 101 Cytoplasmic Ribosomal Protein gene family AT5G02960 78.723 2.84e-21 82.4
Smso29g00670 . 55 101 Cytoplasmic Ribosomal Protein gene family AT5G02960 78.723 2.84e-21 82.4
Smso29g00913 ACH,SST 21 213 Cytoplasmic Ribosomal Protein gene family AT3G11250 21.5 1.39e-09 55.5
Smso29g00955 SST 1 387 Cytoplasmic Ribosomal Protein gene family AT1G61580 87.08 0.0 704.0
Smso29g00956 SST 33 387 Cytoplasmic Ribosomal Protein gene family AT1G61580 85.352 0.0 630.0
Smso29g01040 SST 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 85.185 6.96e-50 150.0
Smso29g01356 ACH 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 2.41e-84 241.0
Smso29g01376 . 1 115 Cytoplasmic Ribosomal Protein gene family AT3G56340 78.261 2.77e-61 184.0
Smso29g01419 . 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso29g01480 WGDA 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 86.26 1.95e-78 226.0
Smso29g01589 . 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.36 7.45e-126 352.0
Smso29g01597 . 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 85.484 6.17e-119 334.0
Smso29g01957 WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.157 4.52e-108 305.0
Smso29g02001 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 69.027 2.20e-33 112.0
Smso29g02006 WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso29g02025 WGDA 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 8.92e-125 350.0
Smso29g02040 . 63 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 63.218 9.21e-27 102.0
Smso29g02336 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.105 1.44e-117 330.0
Smso28g00158 ACH,SST,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 1.60e-92 263.0
Smso28g00237 SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 81.416 7.97e-63 188.0
Smso28g00334 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 87.864 1.26e-136 379.0
Smso28g00363 ACH,SST,WGDA 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.733 5.80e-77 222.0
Smso28g00425 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.06 6.06e-83 241.0
Smso28g00483 ACH,SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 3.13e-120 336.0
Smso28g00606 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 1.84e-49 155.0
Smso28g00607 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 2.60e-48 156.0
Smso28g00711 . 3 66 Cytoplasmic Ribosomal Protein gene family AT2G34480 82.812 7.89e-36 117.0
Smso28g00785 ACH 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.545 1.80e-124 352.0
Smso28g00802 . 1 47 Cytoplasmic Ribosomal Protein gene family AT3G09500 85.106 3.54e-21 79.7
Smso28g00984 SST 99 216 Cytoplasmic Ribosomal Protein gene family AT3G51190 40.678 4.58e-23 91.3
Smso28g01228 ACH,SST,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.157 3.06e-108 305.0
Smso28g01331 ACH,SST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso28g01399 ACH,SST 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 81.379 4.59e-78 229.0
Smso28g01428 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 44.0 3.06e-10 55.5
Smso28g01607 SST,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 8.66e-58 171.0
Smso28g01635 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 7.15e-47 157.0
Smso28g01689 SST,WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.105 4.02e-117 328.0
Smso28g01694 SST,WGDA 1 82 Cytoplasmic Ribosomal Protein gene family AT3G52590 41.463 5.69e-11 58.9
Smso27g00081 SST 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 1.84e-166 459.0
Smso27g00094 SST 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 39.437 6.55e-08 51.2
Smso27g00146 SST 1 386 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.637 0.0 715.0
Smso27g00249 . 1 61 Cytoplasmic Ribosomal Protein gene family AT3G52590 34.426 1.68e-06 45.4
Smso27g00271 ACH,SST 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 80.102 1.13e-110 313.0
Smso27g00335 ACH,SST 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.86 0.0 496.0
Smso27g00390 ACH,SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 2.42e-64 192.0
Smso27g00517 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 87.671 3.88e-94 273.0
Smso27g00716 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.549 4.10e-172 474.0
Smso27g01127 SST 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 70.504 5.81e-66 194.0
Smso27g01228 SST 1 193 Cytoplasmic Ribosomal Protein gene family AT1G33140 82.902 1.72e-118 332.0
Smso27g01399 ACH,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 1.38e-117 332.0
Smso27g01442 SST 1 68 Cytoplasmic Ribosomal Protein gene family AT3G47370 45.588 7.79e-11 57.8
Smso27g01491 SST,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 87.368 1.93e-57 170.0
Smso27g01825 . 105 206 Cytoplasmic Ribosomal Protein gene family AT2G27530 30.769 6.48e-07 47.4
Smso27g02014 ACH 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 9.55e-96 272.0
Smso27g02085 SST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.482 1.68e-76 224.0
Smso27g02144 ACH,SST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 83.537 6.56e-102 289.0
Smso27g02173 ACH,SST 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 84.817 1.83e-124 350.0
Smso27g02211 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 66.957 1.13e-32 108.0
Smso27g02274 ACH,SST 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 88.554 9.15e-108 303.0
Smso26g00036 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 88.489 1.84e-90 258.0
Smso26g00045 ACH,SST 11 107 Cytoplasmic Ribosomal Protein gene family AT3G05560 84.536 8.23e-44 144.0
Smso26g00052 ACH,SST 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.559 3.84e-120 337.0
Smso26g00129 ACH,SST,WGDA 18 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 43.636 1.65e-07 48.1
Smso26g00264 WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 90.323 4.60e-57 169.0
Smso26g00352 SST 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.87 9.12e-40 128.0
Smso26g00436 ACH,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 4.70e-101 285.0
Smso26g00480 SST,WGDA 15 132 Cytoplasmic Ribosomal Protein gene family AT4G18730 26.562 2.35e-06 45.1
Smso26g00524 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso26g00601 SST,WGDA 44 113 Cytoplasmic Ribosomal Protein gene family AT2G31610 94.286 3.39e-42 135.0
Smso26g00632 ACH,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Smso26g00809 ACH,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 94.203 6.42e-44 134.0
Smso26g00862 ACH,SST,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.328 1.55e-79 229.0
Smso26g00890 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 2.80e-137 380.0
Smso26g00910 ACH,WGDA 53 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 90.123 1.97e-53 160.0
Smso26g00921 ACH,WGDA 48 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 80.556 1.23e-39 125.0
Smso26g01060 ACH,SST,WGDA 100 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 88.108 3.08e-116 329.0
Smso26g01065 ACH,WGDA 1 121 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.562 7.99e-80 232.0
Smso26g01094 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso26g01115 ACH,SST 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 9.48e-93 263.0
Smso26g01268 ACH 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 82.192 0.0 502.0
Smso26g01415 ACH,SST 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.931 0.0 498.0
Smso26g01417 ACH,SST 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.931 0.0 498.0
Smso26g01820 WGDA 21 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 43.885 7.06e-33 112.0
Smso26g02098 WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 84.247 7.76e-90 256.0
Smso26g02200 . 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 85.024 3.64e-109 310.0
Smso26g02337 ACH,SST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.071 5.08e-74 217.0
Smso26g02383 ACH 1 88 Cytoplasmic Ribosomal Protein gene family AT3G55280 77.273 3.86e-31 105.0
Smso26g02925 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 93.023 2.01e-58 172.0
Smso26g03015 . 54 153 Cytoplasmic Ribosomal Protein gene family AT1G23410 84.0 4.46e-46 145.0
Smso25g00107 SST,WGDA 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 1.46e-90 263.0
Smso25g00220 SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.641 3.09e-163 451.0
Smso25g00448 ACH,SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 81.675 4.09e-113 321.0
Smso25g00449 SST,WGDA 25 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 75.595 7.12e-87 253.0
Smso25g00614 SST,WGDA 23 121 Cytoplasmic Ribosomal Protein gene family AT3G45030 31.0 9.60e-08 47.0
Smso25g00620 SST,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 86.473 5.15e-128 360.0
Smso25g00684 ACH,SST,WGDA 97 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 92.593 3.22e-110 312.0
Smso25g00754 SST,WGDA 13 126 Cytoplasmic Ribosomal Protein gene family AT3G07110 31.061 6.55e-07 46.6
Smso25g00815 SST,WGDA 59 242 Cytoplasmic Ribosomal Protein gene family AT2G01250 89.674 2.57e-123 346.0
Smso25g01181 WGDA 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 5.32e-166 457.0
Smso25g01307 SST,WGDA 3 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 30.882 2.45e-07 48.5
Smso25g01716 ACH,SST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.364 5.96e-86 247.0
Smso25g01766 ACH,SST,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 90.196 1.95e-126 353.0
Smso25g01914 ACH,SST 1 112 Cytoplasmic Ribosomal Protein gene family AT1G07070 89.286 3.38e-74 215.0
Smso25g01989 ACH,SST,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 86.364 1.08e-72 213.0
Smso25g01995 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 7.19e-72 208.0
Smso25g02069 SST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 1.16e-80 232.0
Smso25g02091 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso25g02181 ACH,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Smso25g02300 ACH,SST 1 88 Cytoplasmic Ribosomal Protein gene family AT3G53430 88.636 7.98e-51 155.0
Smso25g02327 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.468 1.11e-33 111.0
Smso25g02330 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso25g02406 . 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 1.50e-71 207.0
Smso25g02415 . 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 8.98e-75 218.0
Smso25g02464 . 1 69 Cytoplasmic Ribosomal Protein gene family AT1G07070 89.855 6.94e-42 131.0
Smso25g02467 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.532 2.38e-176 489.0
Smso25g02594 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 1.45e-82 242.0
Smso25g02606 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 1.18e-58 175.0
Smso25g02635 . 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 1.23e-86 250.0
Smso25g02680 . 1 111 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.288 3.19e-71 206.0
Smso25g02695 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 64.655 6.22e-45 139.0
Smso25g02744 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 88.725 2.17e-124 348.0
Smso25g02852 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 82.222 1.50e-81 235.0
Smso25g02873 . 43 119 Cytoplasmic Ribosomal Protein gene family AT2G16360 81.818 3.91e-43 134.0
Smso24g00038 SST,WGDA 85 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 36.111 1.98e-07 45.8
Smso24g00099 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT2G44860 70.37 1.16e-78 229.0
Smso24g00186 SST,WGDA 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 3.13e-06 43.1
Smso24g00270 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso24g00442 ACH,SST,WGDA 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 80.556 6.86e-148 415.0
Smso24g00494 . 1 36 Cytoplasmic Ribosomal Protein gene family AT4G27090 69.444 9.19e-10 52.8
Smso24g00502 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 72.727 4.47e-74 216.0
Smso24g00530 . 31 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 81.538 3.00e-32 107.0
Smso24g00619 ACH,SST,WGDA 14 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 47.518 1.13e-34 117.0
Smso24g00652 ACH,SST,WGDA 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 84.647 7.03e-153 424.0
Smso24g00661 SST 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.928 7.72e-92 262.0
Smso24g00702 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 2.70e-54 163.0
Smso24g00828 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.679 1.28e-95 271.0
Smso24g00886 . 42 76 Cytoplasmic Ribosomal Protein gene family AT2G16360 77.143 1.49e-13 62.0
Smso24g01040 . 1 176 Cytoplasmic Ribosomal Protein gene family AT4G25740 65.816 1.18e-70 210.0
Smso24g01076 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 4.43e-125 352.0
Smso24g01437 SST,WGDA 48 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 77.778 5.22e-83 246.0
Smso24g01447 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 79.47 7.96e-82 236.0
Smso24g01618 SST 50 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 31.034 7.10e-10 54.3
Smso24g01894 ACH,SST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.278 8.17e-10 55.8
Smso24g02068 ACH,SST 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.405 4.21e-164 457.0
Smso24g02072 ACH,SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 92.391 2.37e-59 174.0
Smso24g02142 ACH,SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 94.203 6.42e-44 134.0
Smso24g02435 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Smso24g02453 SST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 89.732 7.94e-150 416.0
Smso24g02642 SST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.964 3.28e-152 422.0
Smso24g02643 SST,WGDA 10 243 Cytoplasmic Ribosomal Protein gene family AT2G31610 86.441 3.56e-145 404.0
Smso24g02776 ACH,SST,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Smso24g02901 ACH,SST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 36.486 3.76e-07 48.1
Smso23g00170 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.826 3.85e-32 109.0
Smso23g00199 ACH,SST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 1.03e-101 288.0
Smso23g00232 SST,WGDA 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 79.333 8.18e-78 225.0
Smso23g00251 ACH,SST,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 1.32e-95 282.0
Smso23g00322 SST 1 82 Cytoplasmic Ribosomal Protein gene family AT3G06680 65.854 6.18e-33 107.0
Smso23g00362 ACH,SST,WGDA 1 106 Cytoplasmic Ribosomal Protein gene family AT3G52590 35.088 6.93e-09 53.1
Smso23g00433 SST 1 129 Cytoplasmic Ribosomal Protein gene family AT4G29430 74.419 2.24e-74 215.0
Smso23g00434 SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 3.42e-116 329.0
Smso23g00675 SST,WGDA 7 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 77.297 6.32e-109 307.0
Smso23g00859 SST,WGDA 2 151 Cytoplasmic Ribosomal Protein gene family AT1G29970 45.679 2.85e-32 111.0
Smso23g00860 SST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 87.5 1.27e-118 331.0
Smso23g00933 SST,WGDA 1 243 Cytoplasmic Ribosomal Protein gene family AT2G31610 79.424 4.32e-134 375.0
Smso23g00934 SST,WGDA 1 237 Cytoplasmic Ribosomal Protein gene family AT2G31610 87.029 1.83e-152 422.0
Smso23g01136 . 4 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 43.056 3.73e-09 53.9
Smso23g01160 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 1.31e-08 51.2
Smso23g01183 . 118 208 Cytoplasmic Ribosomal Protein gene family AT2G31610 75.824 3.34e-43 140.0
Smso23g01205 . 86 152 Cytoplasmic Ribosomal Protein gene family AT3G02560 62.687 1.48e-23 90.1
Smso23g01316 SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.938 9.28e-171 473.0
Smso23g01447 SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.77 4.84e-65 194.0
Smso22g00072 SST 28 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 76.087 2.58e-44 139.0
Smso22g00292 . 2 51 Cytoplasmic Ribosomal Protein gene family AT3G02190 94.0 1.75e-30 100.0
Smso22g00351 SST 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso22g00383 . 21 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 63.441 8.73e-17 67.8
Smso22g00784 WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 1.63e-06 42.4
Smso22g00802 WGDA 20 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 34.862 3.95e-10 53.5
Smso22g00924 SST 4 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 80.446 0.0 665.0
Smso22g01398 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT3G02080 81.818 9.64e-88 254.0
Smso22g01692 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.795 2.93e-83 239.0
Smso22g01709 SST 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 86.282 1.25e-177 492.0
Smso22g01813 SST 9 211 Cytoplasmic Ribosomal Protein gene family AT2G27530 25.238 4.05e-06 45.8
Smso22g02100 ACH,SST,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT5G61170 86.429 3.09e-91 259.0
Smso22g02138 . 27 91 Cytoplasmic Ribosomal Protein gene family AT1G26880 87.692 3.67e-31 116.0
Smso22g02167 ACH,SST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.963 9.60e-112 316.0
Smso22g02234 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 83.562 5.55e-90 259.0
Smso22g02288 ACH,SST,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.857 1.75e-120 335.0
Smso22g02380 ACH,SST,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 1.63e-07 48.9
Smso22g02402 ACH,SST 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.77 4.11e-66 196.0
Smso22g02406 ACH,SST,WGDA 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 57.2 1.16e-88 270.0
Smso21g00110 . 5 110 Cytoplasmic Ribosomal Protein gene family AT2G40010 50.467 8.61e-28 102.0
Smso21g00245 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.532 7.21e-177 490.0
Smso21g00563 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 5.63e-70 223.0
Smso21g00575 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 9.21e-59 172.0
Smso21g00627 ACH,SST 6 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 89.535 1.42e-107 330.0
Smso21g00667 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 84.932 3.63e-90 256.0
Smso21g00702 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Smso21g00855 ACH,SST 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 1.10e-72 211.0
Smso21g00869 ACH,SST 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 88.961 1.32e-76 223.0
Smso21g00919 ACH,SST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.071 3.72e-73 223.0
Smso21g01039 ACH,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 1.50e-125 351.0
Smso21g01097 ACH,SST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 85.621 3.69e-86 248.0
Smso21g01130 ACH,SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 1.23e-83 243.0
Smso21g01251 . 1 141 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.454 1.44e-99 282.0
Smso21g01253 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.053 8.79e-108 302.0
Smso21g01254 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Smso21g01307 ACH,SST,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 88.235 4.28e-125 349.0
Smso21g01308 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Smso21g01409 ACH,SST,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 1.55e-08 51.6
Smso21g01586 ACH,SST 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 1.10e-119 334.0
Smso21g01689 ACH,SST,WGDA 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 1.47e-58 175.0
Smso21g01733 ACH,SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso21g01739 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.526 1.73e-37 123.0
Smso21g01762 ACH,SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 3.46e-101 285.0
Smso21g01789 ACH,SST,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 82.403 1.98e-126 355.0
Smso21g01806 ACH,SST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso21g02154 ACH,SST 1 260 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.231 0.0 496.0
Smso21g02187 WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso21g02189 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 3.83e-85 245.0
Smso21g02269 ACH,SST 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 5.18e-120 335.0
Smso21g02329 SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 82.791 8.31e-126 352.0
Smso21g02470 . 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 7.11e-99 280.0
Smso21g02531 . 36 122 Cytoplasmic Ribosomal Protein gene family AT4G18100 52.632 1.19e-23 87.4
Smso21g02623 ACH,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 1.95e-92 262.0
Smso21g02778 SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 76.812 4.46e-31 105.0
Smso21g02792 SST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 3.62e-146 409.0
Smso21g03018 ACH,SST,WGDA 127 195 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.435 4.06e-06 43.5
Smso21g03037 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.77 3.69e-168 463.0
Smso20g00234 ACH,SST,WGDA 13 147 Cytoplasmic Ribosomal Protein gene family AT4G00100 66.667 3.28e-53 167.0
Smso20g00413 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso20g00506 ACH,SST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 2.72e-120 335.0
Smso20g00642 ACH,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 8.17e-127 354.0
Smso20g00782 ACH,SST,WGDA 1 205 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.36 4.73e-123 347.0
Smso20g00786 ACH,SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 3.61e-120 336.0
Smso20g00796 ACH,SST,WGDA 31 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 91.489 1.55e-49 151.0
Smso20g00877 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 2.36e-84 243.0
Smso20g00879 ACH,SST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso20g00973 ACH,SST,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.328 2.92e-79 228.0
Smso20g01043 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.835 5.59e-138 382.0
Smso20g01085 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 9.40e-84 239.0
Smso20g01098 ACH,SST,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 81.667 3.46e-69 201.0
Smso20g01225 . 61 170 Cytoplasmic Ribosomal Protein gene family AT4G34670 76.364 5.29e-58 178.0
Smso20g01280 ACH,WGDA 60 272 Cytoplasmic Ribosomal Protein gene family AT1G58983 69.907 1.74e-99 288.0
Smso20g01358 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 2.02e-91 259.0
Smso20g01409 . 4 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.097 7.49e-143 396.0
Smso20g01449 . 1 115 Cytoplasmic Ribosomal Protein gene family AT3G56340 78.261 1.91e-61 184.0
Smso20g01462 . 160 263 Cytoplasmic Ribosomal Protein gene family AT5G39740 71.154 4.66e-49 157.0
Smso20g01608 ACH 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso20g01690 ACH,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.328 4.05e-77 224.0
Smso20g01768 . 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 77.397 3.01e-82 236.0
Smso20g01821 SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.099 9.65e-125 349.0
Smso20g01828 SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 85.484 2.84e-119 335.0
Smso20g01936 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 83.262 2.84e-125 354.0
Smso20g02090 . 75 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 32.593 6.40e-09 50.4
Smso20g02226 ACH,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.759 1.42e-108 305.0
Smso20g02272 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.142 5.53e-33 110.0
Smso20g02277 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 2.27e-128 362.0
Smso20g02305 ACH,WGDA 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 84.817 7.64e-125 350.0
Smso20g02321 . 4 137 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.353 2.08e-72 224.0
Smso20g02456 . 202 298 Cytoplasmic Ribosomal Protein gene family AT5G02870 76.289 4.15e-45 150.0
Smso20g02553 . 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 1.11e-57 171.0
Smso20g02554 WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 1.11e-57 171.0
Smso20g02606 ACH 9 82 Cytoplasmic Ribosomal Protein gene family AT3G06680 74.324 1.36e-32 107.0
Smso20g02619 WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.632 6.88e-118 330.0
Smso20g02621 WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G62250 38.889 4.65e-07 47.4
Smso19g00048 ACH,SST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso19g00085 ACH,SST,WGDA 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 83.495 5.53e-110 313.0
Smso19g00130 SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 91.391 2.02e-99 280.0
Smso19g00175 WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 59.483 3.39e-36 120.0
Smso19g00191 SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 3.88e-60 177.0
Smso19g00846 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Smso19g00849 WGDA 1 85 Cytoplasmic Ribosomal Protein gene family AT5G39850 90.588 1.87e-51 157.0
Smso19g00850 SST 120 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 79.412 3.64e-37 121.0
Smso19g01689 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 3.75e-48 157.0
Smso19g01759 SST 1 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.0 9.46e-10 55.8
Smso18g00092 ACH,SST,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 84.167 7.69e-71 206.0
Smso18g00419 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 93.333 3.66e-68 199.0
Smso18g00543 . 68 90 Cytoplasmic Ribosomal Protein gene family AT4G36130 73.913 2.00e-06 42.0
Smso18g00827 . 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Smso18g00887 SST,WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 35.714 9.89e-06 42.7
Smso18g00999 . 56 96 Cytoplasmic Ribosomal Protein gene family AT5G02960 82.927 7.24e-18 72.0
Smso18g01115 ACH,SST,WGDA 21 180 Cytoplasmic Ribosomal Protein gene family AT3G11250 24.242 9.13e-10 55.8
Smso18g01447 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 90.741 2.47e-55 166.0
Smso18g01494 ACH,SST,WGDA 42 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 85.222 7.51e-132 370.0
Smso18g01595 SST,WGDA 13 126 Cytoplasmic Ribosomal Protein gene family AT3G07110 31.061 6.25e-07 46.2
Smso18g01714 ACH,WGDA 97 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 92.593 1.99e-110 313.0
Smso18g01783 ACH,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.507 6.50e-127 356.0
Smso18g01803 SST,WGDA 21 117 Cytoplasmic Ribosomal Protein gene family AT3G47370 30.612 4.52e-07 45.1
Smso18g02012 SST,WGDA 57 186 Cytoplasmic Ribosomal Protein gene family AT3G49010 80.0 3.18e-73 218.0
Smso18g02013 ACH,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 82.723 3.75e-115 327.0
Smso18g02451 ACH,SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 85.496 1.16e-161 456.0
Smso18g02457 ACH 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso18g02483 WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 4.56e-71 207.0
Smso18g02545 WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.679 1.28e-95 271.0
Smso18g02641 SST,WGDA 71 152 Cytoplasmic Ribosomal Protein gene family AT5G09510 92.683 2.69e-54 163.0
Smso18g02642 SST,WGDA 5 149 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.586 3.61e-88 261.0
Smso17g00064 ACH,SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.931 0.0 499.0
Smso17g00152 ACH,SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.112 1.92e-126 353.0
Smso17g00264 ACH,SST,WGDA 14 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 90.833 1.02e-78 226.0
Smso17g00266 ACH,SST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 1.43e-107 303.0
Smso17g00362 ACH,SST,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 1.78e-99 280.0
Smso17g00446 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.211 1.68e-82 236.0
Smso17g00488 ACH,SST 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 2.40e-145 403.0
Smso17g00620 ACH,SST,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 2.67e-92 263.0
Smso17g00768 ACH,SST 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 89.431 2.53e-79 228.0
Smso17g00779 ACH,SST 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.232 7.89e-146 409.0
Smso17g00805 SST 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 78.261 1.24e-31 106.0
Smso17g01132 ACH 45 154 Cytoplasmic Ribosomal Protein gene family AT2G39460 45.217 2.91e-23 89.4
Smso17g01445 ACH 1 139 Cytoplasmic Ribosomal Protein gene family AT5G61170 85.612 3.89e-90 256.0
Smso17g01488 ACH 21 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 64.912 1.69e-77 227.0
Smso17g01575 ACH,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.286 1.31e-117 330.0
Smso17g01628 ACH 1 64 Cytoplasmic Ribosomal Protein gene family AT3G62250 44.776 1.18e-06 46.2
Smso17g01641 ACH 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 58.0 2.92e-93 274.0
Smso17g01771 . 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 74.825 6.79e-76 221.0
Smso17g02005 . 105 206 Cytoplasmic Ribosomal Protein gene family AT2G27530 29.808 8.46e-07 47.8
Smso17g02147 . 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 82.517 2.82e-89 254.0
Smso17g02155 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 39.437 4.10e-08 52.0
Smso17g02240 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 87.963 9.96e-54 161.0
Smso17g02360 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 1.08e-80 232.0
Smso17g02399 . 76 123 Cytoplasmic Ribosomal Protein gene family AT5G27850 77.083 7.28e-19 73.9
Smso17g02503 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 87.5 4.88e-71 206.0
Smso17g02515 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 64.655 6.87e-46 142.0
Smso17g02624 . 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 5.42e-86 248.0
Smso17g02634 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 2.15e-58 174.0
Smso17g02644 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 81.41 3.39e-83 241.0
Smso17g02673 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 90.0 6.07e-40 128.0
Smso17g02912 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.381 2.00e-168 464.0
Smso17g03170 . 71 119 Cytoplasmic Ribosomal Protein gene family AT1G69620 73.469 1.02e-17 75.1
Smso17g03241 ACH,SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 80.531 6.62e-63 186.0
Smso17g03248 ACH,SST,WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 3.58e-50 150.0
Smso17g03421 ACH,SST,WGDA 25 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 75.0 1.61e-64 191.0
Smso16g00042 ACH,SST,WGDA 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.869 1.25e-153 429.0
Smso16g00246 ACH,SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.131 1.05e-63 191.0
Smso16g00329 ACH,SST 1 161 Cytoplasmic Ribosomal Protein gene family AT1G67430 88.199 3.26e-103 291.0
Smso16g00440 ACH,SST,WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 1.98e-49 149.0
Smso16g00446 ACH,SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 80.531 1.29e-62 186.0
Smso16g00624 . 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 90.845 4.09e-90 256.0
Smso16g00939 SST 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso16g01392 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 89.937 1.28e-94 269.0
Smso16g01654 ACH,SST,WGDA 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 85.062 6.37e-154 426.0
Smso16g01689 ACH,SST,WGDA 21 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 46.667 5.45e-31 107.0
Smso16g01866 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 75.524 2.32e-76 222.0
Smso16g01899 SST 87 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 33.846 1.11e-07 45.4
Smso16g01928 SST,WGDA 12 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.927 4.21e-148 420.0
Smso16g02107 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso16g02228 SST,WGDA 127 204 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.769 2.97e-06 44.7
Smso16g02314 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT2G44860 70.625 1.99e-79 231.0
Smso16g02374 ACH,SST,WGDA 85 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 34.722 1.31e-07 46.2
Smso15g00009 . 66 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 92.053 1.68e-85 248.0
Smso15g00574 . 13 78 Cytoplasmic Ribosomal Protein gene family AT3G52590 93.939 9.91e-40 129.0
Smso15g00881 WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 1.02e-06 42.7
Smso15g00892 WGDA 20 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 34.862 1.04e-09 53.5
Smso15g00939 WGDA 19 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 79.639 0.0 626.0
Smso15g01351 WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 81.818 6.55e-89 253.0
Smso15g01363 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.028 1.29e-07 50.4
Smso15g01536 ACH 60 154 Cytoplasmic Ribosomal Protein gene family AT2G39460 50.526 8.91e-24 90.9
Smso15g01846 ACH 127 199 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.137 3.35e-06 43.5
Smso15g01876 ACH,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT5G61170 83.916 3.56e-90 256.0
Smso15g02018 ACH,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.286 3.64e-119 335.0
Smso15g02071 ACH,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 4.08e-07 47.8
Smso15g02088 ACH,WGDA 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 58.8 4.67e-93 273.0
Smso15g02278 . 1 25 Cytoplasmic Ribosomal Protein gene family AT4G33865 64.0 2.02e-07 42.0
Smso14g00076 ACH 1 189 Cytoplasmic Ribosomal Protein gene family AT2G31610 71.429 3.74e-90 261.0
Smso14g00121 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 1.17e-70 205.0
Smso14g00138 ACH 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 85.714 3.38e-73 214.0
Smso14g00223 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.5 1.19e-178 494.0
Smso14g00444 . 4 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 85.714 2.65e-49 150.0
Smso14g00475 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 82.222 2.36e-81 235.0
Smso14g00594 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 90.196 6.96e-126 352.0
Smso14g00637 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 64.655 4.77e-44 137.0
Smso14g00651 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 87.5 5.33e-71 205.0
Smso14g00744 ACH 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 1.88e-86 250.0
Smso14g00781 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 3.08e-58 174.0
Smso14g00794 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 1.32e-83 243.0
Smso14g01085 SST,WGDA 4 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 81.141 0.0 670.0
Smso14g01398 . 1 63 Cytoplasmic Ribosomal Protein gene family AT5G64140 90.625 4.14e-35 113.0
Smso14g01472 . 59 96 Cytoplasmic Ribosomal Protein gene family AT5G02960 86.842 5.89e-17 69.7
Smso14g01497 . 5 80 Cytoplasmic Ribosomal Protein gene family AT5G28060 73.077 5.66e-38 123.0
Smso14g01663 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT3G02080 81.119 2.12e-87 249.0
Smso14g01720 . 56 100 Cytoplasmic Ribosomal Protein gene family AT4G34670 73.913 3.77e-13 64.7
Smso14g02009 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.795 2.93e-83 239.0
Smso14g02028 SST 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 85.56 1.18e-176 489.0
Smso14g02126 SST 9 211 Cytoplasmic Ribosomal Protein gene family AT2G27530 25.714 1.01e-06 47.8
Smso14g02132 . 61 162 Cytoplasmic Ribosomal Protein gene family AT4G34670 82.353 2.75e-59 181.0
Smso14g02386 ACH 109 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 91.216 9.09e-101 288.0
Smso14g02430 ACH,SST,WGDA 29 140 Cytoplasmic Ribosomal Protein gene family AT5G61170 75.893 2.20e-59 177.0
Smso14g02471 . 32 113 Cytoplasmic Ribosomal Protein gene family AT1G26880 87.805 7.60e-42 146.0
Smso14g02497 ACH,SST 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 79.058 5.61e-113 319.0
Smso14g02570 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 83.562 1.27e-89 259.0
Smso14g02626 ACH,SST,WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.857 1.75e-120 335.0
Smso14g02693 . 195 233 Cytoplasmic Ribosomal Protein gene family AT1G58983 84.615 4.03e-14 68.2
Smso14g02727 ACH,SST,WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 43.243 1.54e-07 48.5
Smso14g02748 ACH,SST 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 74.59 7.64e-66 195.0
Smso14g02751 ACH,WGDA 1 199 Cytoplasmic Ribosomal Protein gene family AT1G80750 56.436 1.46e-69 213.0
Smso14g02913 . 118 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 83.178 4.89e-60 184.0
Smso14g02914 . 13 74 Cytoplasmic Ribosomal Protein gene family AT2G31610 82.258 4.89e-28 100.0
Smso13g00209 WGDA 21 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 46.043 3.41e-34 115.0
Smso13g00557 . 120 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 85.315 3.75e-91 265.0
Smso13g00565 SST 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.55 0.0 497.0
Smso13g00568 SST 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.55 0.0 497.0
Smso13g00746 ACH,SST,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 1.26e-92 262.0
Smso13g00757 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso13g00782 ACH,SST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 1.13e-146 410.0
Smso13g00879 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 2.18e-137 381.0
Smso13g00894 ACH,SST,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 85.821 4.94e-80 230.0
Smso13g01065 SST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.964 3.22e-151 421.0
Smso13g01143 SST,WGDA 15 132 Cytoplasmic Ribosomal Protein gene family AT4G18730 26.562 2.12e-06 45.4
Smso13g01174 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso13g01212 SST 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.526 2.77e-37 124.0
Smso13g01339 ACH,SST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 38.889 9.73e-10 55.5
Smso13g01394 SST 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 1.09e-119 336.0
Smso12g00166 ACH,SST,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 3.43e-122 353.0
Smso12g00423 ACH,SST,WGDA 38 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 93.162 1.55e-67 198.0
Smso12g00428 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 88.525 8.20e-72 208.0
Smso12g00500 SST 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 2.35e-92 263.0
Smso12g00557 SST,WGDA 2 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 79.104 6.65e-79 227.0
Smso12g00595 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso12g00604 SST 1 140 Cytoplasmic Ribosomal Protein gene family AT5G04800 81.119 3.19e-77 224.0
Smso12g00695 ACH,SST,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 1.70e-94 288.0
Smso12g00871 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.544 5.05e-34 112.0
Smso12g00880 ACH,SST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso12g01237 ACH,SST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.795 3.35e-82 236.0
Smso12g01373 SST,WGDA 5 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.818 3.63e-07 47.8
Smso12g01555 SST,WGDA 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 91.566 6.20e-167 459.0
Smso12g01564 SST 33 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 84.492 0.0 647.0
Smso12g01565 SST 19 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 82.99 0.0 654.0
Smso12g01755 . 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 100.0 2.33e-50 155.0
Smso12g01827 ACH,SST 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 9.31e-101 286.0
Smso12g02741 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 2.28e-48 156.0
Smso12g02803 SST 1 74 Cytoplasmic Ribosomal Protein gene family AT3G62250 40.0 8.35e-10 56.6
Smso12g03094 SST,WGDA 61 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 87.402 5.60e-83 240.0
Smso12g03100 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Smso12g03546 SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso12g03600 WGDA 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 4.36e-53 177.0
Smso12g03709 SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.053 7.70e-101 284.0
Smso12g03767 ACH,SST,WGDA 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.974 4.09e-126 355.0
Smso12g03831 ACH,SST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso12g04048 . 118 208 Cytoplasmic Ribosomal Protein gene family AT2G31610 83.516 3.14e-53 166.0
Smso12g04096 SST,WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 6.27e-06 40.8
Smso12g04102 . 302 348 Cytoplasmic Ribosomal Protein gene family AT3G09630 59.574 3.46e-07 45.1
Smso11g00115 WGDA 20 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 33.945 3.87e-10 53.5
Smso11g00147 SST,WGDA 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 3.98e-06 41.2
Smso11g01229 ACH,SST 1 126 Cytoplasmic Ribosomal Protein gene family AT1G09690 80.159 4.71e-72 212.0
Smso11g01306 . 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 100.0 2.68e-50 155.0
Smso11g01475 SST 3 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 82.673 0.0 679.0
Smso11g01488 SST,WGDA 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 5.32e-166 457.0
Smso11g01671 SST,WGDA 5 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.818 6.04e-07 47.0
Smso11g01801 ACH,SST,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 81.457 6.38e-84 241.0
Smso11g02194 ACH,SST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.352 1.12e-129 362.0
Smso11g02201 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.544 1.74e-29 111.0
Smso11g02485 SST 1 140 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.517 5.95e-78 226.0
Smso11g02495 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso11g02595 SST 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 4.28e-92 264.0
Smso11g02674 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 8.49e-73 213.0
Smso11g02680 ACH,SST,WGDA 85 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 98.571 5.13e-43 134.0
Smso11g02956 ACH,SST,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 2.96e-121 353.0
Smso10g00103 . 1 69 Cytoplasmic Ribosomal Protein gene family AT3G52590 54.93 2.36e-12 58.9
Smso10g00215 ACH,SST 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 93.377 8.03e-102 286.0
Smso10g00359 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Smso10g00440 ACH,SST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 2.72e-120 335.0
Smso10g00675 ACH,SST 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.762 3.82e-126 353.0
Smso10g00678 ACH,SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.559 1.62e-120 337.0
Smso10g00687 ACH,SST,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 85.714 2.26e-62 185.0
Smso10g00761 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 2.23e-84 242.0
Smso10g00763 ACH,SST,WGDA 30 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.935 1.43e-86 247.0
Smso10g00840 ACH,SST,WGDA 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 82.836 6.17e-77 222.0
Smso10g00893 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.835 1.12e-137 382.0
Smso10g00928 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 86.466 7.65e-84 241.0
Smso10g00935 . 1 62 Cytoplasmic Ribosomal Protein gene family AT5G56670 95.161 1.18e-29 101.0
Smso10g00940 ACH,SST,WGDA 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 81.667 6.25e-69 203.0
Smso10g00964 ACH 85 139 Cytoplasmic Ribosomal Protein gene family AT1G29970 40.351 4.33e-07 44.7
Smso10g01108 ACH,SST,WGDA 1 121 Cytoplasmic Ribosomal Protein gene family AT3G47370 93.388 2.23e-81 234.0
Smso10g01157 . 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 1.31e-91 259.0
Smso10g01208 ACH,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 96.923 4.70e-91 258.0
Smso10g01659 . 1 67 Cytoplasmic Ribosomal Protein gene family AT4G10450 71.642 2.09e-29 103.0
Smso10g01789 . 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 81.849 1.07e-180 501.0
Smso10g01858 . 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 91.803 7.44e-77 228.0
Smso10g02220 ACH,SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 80.531 1.61e-62 185.0
Smso10g02228 ACH,SST,WGDA 10 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 84.722 5.67e-45 137.0
Smso10g02296 ACH,SST,WGDA 1 172 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.116 1.53e-117 328.0
Smso10g02364 ACH,SST,WGDA 25 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.333 2.97e-64 190.0
Smso10g02539 ACH,SST 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.072 1.55e-152 427.0
Smso10g02595 ACH,SST,WGDA 38 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 30.0 5.36e-08 47.4
Smso10g02644 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT2G44860 69.277 6.01e-79 229.0
Smso10g02741 SST,WGDA 127 204 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.769 1.98e-06 43.5
Smso10g02868 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 7.53e-70 203.0
Smso10g03065 ACH,SST,WGDA 12 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 83.333 3.56e-148 418.0
Smso10g03101 SST 87 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 33.846 2.53e-08 48.9
Smso10g03134 SST,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 73.427 1.28e-73 215.0
Smso10g03296 ACH,SST,WGDA 6 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 40.719 1.84e-30 106.0
Smso10g03327 ACH,SST,WGDA 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 85.477 7.14e-154 426.0
Smso10g03541 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.679 1.28e-95 271.0
Smso10g03806 . 11 54 Cytoplasmic Ribosomal Protein gene family AT3G53870 84.091 8.65e-20 78.6
Smso10g03850 SST 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 94.444 8.83e-128 355.0
Smso9g00072 SST,WGDA 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 2.35e-92 263.0
Smso9g00073 SST 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.671 5.52e-92 261.0
Smso9g00199 WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.26 1.65e-162 451.0
Smso9g00401 ACH,SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 2.16e-117 330.0
Smso9g00497 . 1 78 Cytoplasmic Ribosomal Protein gene family AT3G52590 97.436 8.37e-50 157.0
Smso9g00537 SST,WGDA 21 119 Cytoplasmic Ribosomal Protein gene family AT3G47370 31.0 1.08e-07 47.0
Smso9g00728 ACH,SST,WGDA 7 242 Cytoplasmic Ribosomal Protein gene family AT2G01250 85.593 8.04e-151 418.0
Smso9g00755 ACH,SST,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 89.815 1.09e-53 164.0
Smso9g00928 ACH,SST,WGDA 21 180 Cytoplasmic Ribosomal Protein gene family AT3G09200 23.636 1.50e-09 55.1
Smso9g01284 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 1.11e-69 204.0
Smso8g00069 ACH,SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 88.55 0.0 497.0
Smso8g00162 ACH,SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.645 2.44e-126 353.0
Smso8g00202 ACH,WGDA 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 84.127 3.01e-62 187.0
Smso8g00268 . 1 47 Cytoplasmic Ribosomal Protein gene family AT5G64140 87.5 2.52e-23 82.4
Smso8g00294 ACH,SST,WGDA 14 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 90.833 1.02e-78 226.0
Smso8g00296 ACH,SST,WGDA 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Smso8g00386 ACH,SST,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 1.19e-99 281.0
Smso8g00471 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.962 1.02e-83 239.0
Smso8g00517 ACH,SST 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 3.94e-145 403.0
Smso8g00668 ACH,SST,WGDA 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 1.09e-92 263.0
Smso8g00819 ACH,SST 1 123 Cytoplasmic Ribosomal Protein gene family AT3G45030 90.244 2.97e-80 230.0
Smso8g00833 ACH,SST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 1.04e-145 410.0
Smso8g00868 SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 78.261 2.94e-30 106.0
Smso8g00882 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
Smso8g01208 ACH,SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 74.59 8.14e-65 194.0
Smso8g01368 SST,WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 7.79e-50 151.0
Smso8g01374 SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 80.531 6.62e-63 186.0
Smso8g01654 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 85.603 1.64e-166 459.0
Smso8g01937 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso8g01938 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Smso8g02089 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.0 1.87e-80 231.0
Smso8g02225 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 87.5 4.88e-71 206.0
Smso8g02258 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 66.379 7.74e-45 139.0
Smso8g02365 . 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.928 9.59e-87 250.0
Smso8g02401 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 80.769 1.53e-81 237.0
Smso8g02451 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 87.879 1.08e-57 175.0
Smso8g02641 SST,WGDA 3 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 30.882 8.18e-08 49.7
Smso8g02760 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 81.457 4.25e-84 241.0
Smso8g03115 ACH,SST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.364 2.50e-85 246.0
Smso8g03181 ACH,SST,WGDA 1 132 Cytoplasmic Ribosomal Protein gene family AT4G16720 90.909 2.76e-73 220.0
Smso8g03306 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 89.344 1.49e-72 211.0
Smso8g03311 ACH,SST,WGDA 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 8.33e-73 213.0
Smso8g03389 ACH,SST 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 90.179 1.87e-74 216.0
Smso8g03524 SST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.741 1.16e-80 232.0
Smso8g03556 ACH,SST,WGDA 2 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 87.85 4.79e-50 156.0
Smso8g03667 ACH,SST,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 1.13e-92 287.0
Smso8g03822 ACH,SST 1 166 Cytoplasmic Ribosomal Protein gene family AT5G60670 90.964 7.45e-109 306.0
Smso7g00467 SST 85 133 Cytoplasmic Ribosomal Protein gene family AT5G63070 44.898 6.50e-10 52.8
Smso7g00597 ACH 1 57 Cytoplasmic Ribosomal Protein gene family AT3G52590 33.333 2.95e-06 44.7
Smso7g00774 ACH,SST 19 213 Cytoplasmic Ribosomal Protein gene family AT3G11250 20.0 1.18e-08 52.8
Smso7g00824 SST 1 387 Cytoplasmic Ribosomal Protein gene family AT1G61580 87.597 0.0 707.0
Smso7g00825 SST 29 387 Cytoplasmic Ribosomal Protein gene family AT1G61580 85.794 0.0 640.0
Smso7g00942 SST 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 85.185 2.49e-50 151.0
Smso7g01954 . 1 290 Cytoplasmic Ribosomal Protein gene family AT2G40010 75.172 6.03e-161 450.0
Smso7g02127 ACH,SST,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.623 5.25e-80 231.0
Smso6g00055 ACH,SST 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 2.22e-08 50.8
Smso6g00182 ACH,SST,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Smso6g00281 . 61 117 Cytoplasmic Ribosomal Protein gene family AT4G34670 82.456 5.53e-30 104.0
Smso6g00309 SST,WGDA 44 237 Cytoplasmic Ribosomal Protein gene family AT2G31610 85.714 4.17e-120 338.0
Smso6g00311 SST,WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 91.964 3.82e-152 424.0
Smso6g00492 SST,WGDA 8 250 Cytoplasmic Ribosomal Protein gene family AT2G31610 76.639 8.87e-127 357.0
Smso6g00515 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 4.56e-59 173.0
Smso6g00802 ACH,SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 92.754 7.19e-43 131.0
Smso6g00889 ACH,SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso6g00899 ACH,SST 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.023 7.36e-163 453.0
Smso6g01090 ACH,SST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.278 2.61e-10 57.4
Smso6g01411 SST 50 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 30.172 1.10e-07 48.9
Smso6g01522 . 14 237 Cytoplasmic Ribosomal Protein gene family AT2G31610 75.664 5.58e-119 338.0
Smso6g01604 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 58.784 2.20e-48 149.0
Smso6g01620 ACH,SST,WGDA 48 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 77.778 2.28e-79 247.0
Smso6g02037 . 89 122 Cytoplasmic Ribosomal Protein gene family AT3G02560 64.706 1.17e-09 52.4
Smso6g02456 . 4 163 Cytoplasmic Ribosomal Protein gene family AT1G18540 81.988 1.49e-91 267.0
Smso5g00044 SST,WGDA 38 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 29.412 9.23e-09 49.3
Smso5g00103 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT2G44860 70.807 5.10e-79 229.0
Smso5g00189 SST,WGDA 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 3.10e-06 43.1
Smso5g00284 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso5g00468 ACH,SST,WGDA 12 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 82.661 6.42e-149 419.0
Smso5g00515 SST,WGDA 35 143 Cytoplasmic Ribosomal Protein gene family AT2G19730 66.972 1.61e-42 137.0
Smso5g00542 . 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 86.316 9.76e-53 176.0
Smso5g00655 SST,WGDA 6 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 45.27 5.29e-34 114.0
Smso5g00676 ACH,SST,WGDA 83 242 Cytoplasmic Ribosomal Protein gene family AT2G44120 91.25 5.01e-108 306.0
Smso5g00685 SST 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 90.647 1.15e-90 264.0
Smso5g00727 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 90.741 3.58e-48 164.0
Smso5g00896 SST,WGDA 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 88.679 1.81e-95 271.0
Smso5g01379 WGDA 1 176 Cytoplasmic Ribosomal Protein gene family AT4G25740 75.138 1.86e-84 245.0
Smso5g01456 ACH,WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT4G16720 91.406 8.87e-72 213.0
Smso5g01582 ACH,SST,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.071 4.58e-75 217.0
Smso5g02273 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 93.023 7.72e-59 172.0
Smso5g02370 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Smso4g00025 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 87.963 1.92e-53 160.0
Smso4g00089 . 82 148 Cytoplasmic Ribosomal Protein gene family AT5G58420 70.149 1.09e-28 102.0
Smso4g00109 . 33 77 Cytoplasmic Ribosomal Protein gene family AT3G09200 51.111 2.47e-09 52.0
Smso4g00530 . 1 220 Cytoplasmic Ribosomal Protein gene family AT1G66580 85.455 3.53e-144 399.0
Smso4g00538 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 7.42e-77 223.0
Smso4g00550 ACH,SST,WGDA 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 9.21e-59 172.0
Smso4g00610 ACH,SST 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.96 8.01e-120 334.0
Smso4g00651 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 84.932 2.82e-91 259.0
Smso4g00684 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Smso4g00864 ACH,SST 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 87.705 1.34e-71 208.0
Smso4g00879 ACH,SST 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 7.88e-75 219.0
Smso4g01050 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.216 6.95e-119 355.0
Smso4g01119 ACH,SST 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 86.275 1.21e-86 249.0
Smso4g01159 ACH,SST,WGDA 1 176 Cytoplasmic Ribosomal Protein gene family AT4G25740 79.121 2.47e-83 243.0
Smso4g01285 . 1 141 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.454 4.06e-99 281.0
Smso4g01341 ACH,SST,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Smso4g01342 ACH,SST,WGDA 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Smso4g01454 ACH 1 105 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.193 5.54e-08 49.3
Smso4g01599 ACH,SST 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 1.10e-119 334.0
Smso4g01698 . 1 102 Cytoplasmic Ribosomal Protein gene family AT5G18380 55.882 9.28e-30 100.0
Smso4g01709 ACH,SST,WGDA 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 2.96e-58 173.0
Smso4g01755 ACH,SST,WGDA 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Smso4g01762 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.0 6.56e-38 123.0
Smso4g01790 ACH,SST,WGDA 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 3.46e-101 285.0
Smso4g01818 ACH,SST,WGDA 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 83.495 2.10e-109 311.0
Smso4g01839 ACH,SST,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Smso4g02247 ACH,SST,WGDA 1 260 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.231 1.22e-180 495.0
Smso4g02341 SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.568 1.27e-122 349.0
Smso4g02371 ACH,SST 75 186 Cytoplasmic Ribosomal Protein gene family AT3G05590 87.5 1.45e-71 210.0
Smso4g02492 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 3.61e-85 244.0
Smso4g02523 . 138 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 66.667 3.55e-31 108.0
Smso4g02524 . 13 100 Cytoplasmic Ribosomal Protein gene family AT2G31610 89.773 1.51e-52 164.0
Smso4g02689 WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 2.54e-98 280.0
Smso4g02885 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT5G59850 91.429 5.84e-68 201.0
Smso4g03081 SST,WGDA 1 69 Cytoplasmic Ribosomal Protein gene family AT4G25890 76.812 2.80e-31 105.0
Smso4g03092 SST,WGDA 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 85.654 5.89e-146 409.0
Smso4g03306 ACH,SST,WGDA 127 195 Cytoplasmic Ribosomal Protein gene family AT2G47610 30.435 6.68e-06 42.7
Smso4g03312 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 86.381 3.13e-166 458.0
Smso3g00074 SST 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 90.763 7.40e-166 456.0
Smso3g00083 SST 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 39.437 5.07e-09 53.9
Smso3g00132 SST 53 386 Cytoplasmic Ribosomal Protein gene family AT1G43170 88.623 0.0 611.0
Smso3g00240 ACH 1 61 Cytoplasmic Ribosomal Protein gene family AT3G52590 34.426 2.07e-06 45.4
Smso3g00279 ACH,SST 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 84.541 3.39e-126 354.0
Smso3g00348 ACH,SST 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.86 0.0 496.0
Smso3g00397 ACH,SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 1.56e-64 191.0
Smso3g00534 ACH,SST 1 146 Cytoplasmic Ribosomal Protein gene family AT1G23290 87.671 1.26e-94 270.0
Smso3g00625 . 1 115 Cytoplasmic Ribosomal Protein gene family AT1G26880 93.913 1.13e-75 218.0
Smso3g00760 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.938 8.45e-172 473.0
Smso3g01352 SST 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.928 2.53e-91 265.0
Smso3g01525 SST 1 193 Cytoplasmic Ribosomal Protein gene family AT1G33140 82.902 7.63e-118 330.0
Smso3g01594 . 1 111 Cytoplasmic Ribosomal Protein gene family AT3G52590 72.321 1.05e-46 145.0
Smso3g01607 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G04400 90.141 7.78e-42 131.0
Smso3g01800 . 116 151 Cytoplasmic Ribosomal Protein gene family AT4G09800 61.111 8.49e-08 46.2
Smso3g01853 SST,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 1.49e-58 172.0
Smso3g02224 SST 105 206 Cytoplasmic Ribosomal Protein gene family AT2G27530 29.808 4.60e-06 45.1
Smso3g02451 SST,WGDA 1 135 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.482 1.10e-76 224.0
Smso3g02515 ACH,SST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 1.03e-101 288.0
Smso3g02543 ACH,SST 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 6.25e-125 351.0
Smso3g02580 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.421 2.62e-33 113.0
Smso3g02643 ACH,SST 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.759 1.42e-108 305.0
Smso2g00259 ACH,SST,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.696 2.32e-32 109.0
Smso2g00276 . 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.34 9.30e-120 352.0
Smso2g00312 ACH,SST,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 2.38e-101 289.0
Smso2g00371 SST,WGDA 1 137 Cytoplasmic Ribosomal Protein gene family AT5G04800 82.143 1.61e-77 225.0
Smso2g00389 SST 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Smso2g00525 ACH,SST 3 82 Cytoplasmic Ribosomal Protein gene family AT3G06680 65.0 5.26e-33 107.0
Smso2g00603 ACH,SST,WGDA 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.5 8.03e-08 50.1
Smso2g00690 ACH,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 5.77e-58 171.0
Smso2g00734 SST 1 129 Cytoplasmic Ribosomal Protein gene family AT4G29430 74.419 2.24e-74 215.0
Smso2g00737 SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 1.15e-115 331.0
Smso2g00845 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 9.86e-46 156.0
Smso2g00904 . 96 251 Cytoplasmic Ribosomal Protein gene family AT2G41840 29.091 1.17e-14 70.9
Smso2g01172 SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.44 9.76e-112 315.0
Smso2g01465 ACH,WGDA 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.29e-127 353.0
Smso2g01594 SST 2 151 Cytoplasmic Ribosomal Protein gene family AT1G29970 46.405 2.96e-33 113.0
Smso2g01595 SST,WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 7.07e-120 334.0
Smso2g01736 SST,WGDA 1 234 Cytoplasmic Ribosomal Protein gene family AT2G31610 88.186 8.87e-153 423.0
Smso2g01737 SST,WGDA 44 237 Cytoplasmic Ribosomal Protein gene family AT2G31610 85.204 2.65e-120 339.0
Smso2g01975 WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.84e-126 352.0
Smso2g02164 . 4 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 43.056 3.63e-09 53.9
Smso2g02178 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 5.28e-08 49.7
Smso2g02242 . 4 64 Cytoplasmic Ribosomal Protein gene family AT5G64140 93.548 8.03e-35 112.0
Smso2g02253 . 27 68 Cytoplasmic Ribosomal Protein gene family AT5G09500 78.571 1.10e-15 69.7
Smso2g02254 . 4 68 Cytoplasmic Ribosomal Protein gene family AT5G09500 69.231 4.92e-25 90.9
Smso2g02576 ACH,SST,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 88.327 1.30e-171 471.0
Smso2g02719 SST,WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 73.77 3.62e-63 193.0
Smso1g00059 SST,WGDA 1 82 Cytoplasmic Ribosomal Protein gene family AT3G52590 41.463 6.31e-11 58.9
Smso1g00065 SST,WGDA 1 190 Cytoplasmic Ribosomal Protein gene family AT4G10450 82.105 4.11e-117 328.0
Smso1g00102 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 3.80e-48 156.0
Smso1g00131 ACH,SST,WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 8.66e-58 171.0
Smso1g00218 . 61 162 Cytoplasmic Ribosomal Protein gene family AT4G34670 83.333 4.60e-61 186.0
Smso1g00339 SST 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 49.65 1.13e-33 111.0
Smso1g00400 ACH,WGDA 91 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 91.453 1.72e-76 223.0
Smso1g00424 ACH,SST,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 88.889 8.33e-129 360.0
Smso1g00531 ACH,SST,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT5G60670 90.361 1.63e-108 307.0
Smso1g00797 SST 99 216 Cytoplasmic Ribosomal Protein gene family AT3G51190 41.525 4.08e-23 91.7
Smso1g00956 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.624 5.52e-118 344.0
Smso1g01225 SST,WGDA 7 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 83.186 3.62e-67 199.0
Smso1g01608 ACH,SST,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Smso1g02105 SST,WGDA 7 242 Cytoplasmic Ribosomal Protein gene family AT2G01250 85.169 3.55e-150 417.0
Smso1g02210 SST,WGDA 13 126 Cytoplasmic Ribosomal Protein gene family AT3G07110 31.061 7.20e-07 46.6
Smso1g02311 ACH,SST,WGDA 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.86 0.0 496.0
Smso1g02385 ACH,SST,WGDA 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.507 1.19e-126 357.0
Smso1g02391 SST,WGDA 21 119 Cytoplasmic Ribosomal Protein gene family AT3G47370 31.0 2.83e-07 45.8
Smso1g02579 SST,WGDA 1 140 Cytoplasmic Ribosomal Protein gene family AT3G49010 86.429 2.44e-83 244.0
Smso1g02581 ACH,SST,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 71.204 2.70e-92 266.0
Smso1g02710 ACH 1 62 Cytoplasmic Ribosomal Protein gene family AT3G59540 95.161 1.59e-38 122.0
Smso1g02962 SST,WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 86.641 7.13e-163 451.0
Smso1g02988 WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 7.01e-72 208.0
Smso1g03059 WGDA 81 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 87.342 9.23e-45 139.0
Smso1g03060 . 1 22 Cytoplasmic Ribosomal Protein gene family AT5G23740 90.909 2.36e-06 40.8
Smso1g03144 SST,WGDA 1 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 86.184 2.62e-92 262.0
Smso1g03604 ACH,SST,WGDA 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.645 1.53e-123 349.0
Smso1g03611 ACH,SST,WGDA 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 87.097 2.62e-121 338.0
Smso1g03620 . 90 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 85.714 8.66e-17 67.4
Smso1g03724 ACH,SST,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 88.806 1.06e-83 242.0
Smso1g03809 ACH,SST,WGDA 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 84.733 8.23e-77 222.0
Smso1g03822 ACH 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Smso1g03867 ACH,SST,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 3.49e-137 380.0
Smso1g03936 ACH 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 81.507 3.30e-180 497.0
Smso1g03953 ACH 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 4.34e-145 401.0
Smso1g03990 SST,WGDA 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 81.416 2.07e-63 189.0
Smso1g04112 ACH,SST,WGDA 14 121 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.222 4.99e-76 219.0
Smso1g04204 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.623 1.32e-80 231.0