AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Soca5g02321 ATGGCTGCAGCTCCTAGCTCTACATCTGTGGTCAAATTCACCCCATTCTTGGGTCAAACTAGATCATCTAGCATCAATACCTTGAGAGATGCTGTCTCTATGCCTGGTGCCAAATTCACCATGAGCAATGACTTGTGGTATGGACCGGACCGTGTTAAGTACTTGGGACCCTTTTCGGCTCAGACCCCGTCTTACTTGACAGGTGAATTCCCCGGTGACTATGGCTGGGACACTGCTGGTTTGTCTGCTGATCCCGAGGCTTTCGCCAAGAACAGGGCTCTTGAGGTTATCCACGGGCGATGGGCTATGCTTGGCGCACTCGGGTGCATTACCCCCGAGGTTCTCGAAAAGTGGGTGAAAGTGGATTTCAAGGAGCCAGTTTGGTTCAAGGCCGGCGCCCAGATTTTCTCTGAAGGTGGTCTGGACTACCTAGGGAACCCGGACCTTGTCCATGCTCAGAGCATATTGGCAGTGCTGGGGTTCCAGGTGATCTTAATGGGCCTTGTTGAGGGTTTCCGTATCAACGGGCTTGACGGAGTTGGAGATGGTAACAACCTATACCCTGGTGGGCAATATTTCGACCCATTGGGCCTTGCTGATGACCCGGTAACATTTGCTGAGTTGAAGGTGAAGGAGATCAAGAATGGTAGATTGGCAATGTTTTCCATGTTTGGGTTCTTTGTGCAAGCAATAGTAACAGGAAAAGGGCCATTGGAGAACTTGTTGGACCATTTGGACAACCCTGTAGCTAACAATGCATGGGTCTATGCCACCAAGTTTGTGCCAGGCTCATAG 795 50.69 MAAAPSSTSVVKFTPFLGQTRSSSINTLRDAVSMPGAKFTMSNDLWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWVKVDFKEPVWFKAGAQIFSEGGLDYLGNPDLVHAQSILAVLGFQVILMGLVEGFRINGLDGVGDGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGS 264
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Soca5g02321 264 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 20 263 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Soca5g02321 264 FunFam Chlorophyll a-b binding protein, chloroplastic 53 257 - -
Soca5g02321 264 Pfam Chlorophyll A-B binding protein 63 231 IPR022796 -
Soca5g02321 264 Gene3D Chlorophyll a-b binding protein domain 53 257 - -
Soca5g02321 264 SUPERFAMILY Chlorophyll a-b binding protein 45 261 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Soca5g02321 K08914 light-harvesting complex II chlorophyll a/b binding protein 3
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Soca Soca-Chr3:93059349 Soca5g02321 Soca-Chr5:24702290 dispersed
Soca Soca-Chr5:24702290 Soca5g04514 Soca-Chr5:59405879 dispersed
Soca Soca-Chr1:52220916 Soca5g02321 Soca-Chr5:24702290 wgd
Soca Soca-Chr4:61499818 Soca5g02321 Soca-Chr5:24702290 wgd
Soca Soca-Chr5:24702290 Soca5g02567 Soca-Chr5:28057684 wgd
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Soca3g00553 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 66.946 5.98e-114 324.0
Soca3g00873 . 37 310 Chloroplast and Mitochondria gene family AT1G25380 25.566 9.75e-29 112.0
Soca9g02302 ACH 7 214 Chloroplast and Mitochondria gene family AT4G25570 45.673 1.67e-61 190.0
Soca9g02303 ACH 4 215 Chloroplast and Mitochondria gene family AT4G25570 44.34 4.20e-60 187.0
Soca9g02505 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.015 1.04e-173 478.0
Soca1g03159 ACH 33 205 Chloroplast and Mitochondria gene family AT1G25380 69.318 6.10e-78 236.0
Soca5g04414 ACH 1 346 Chloroplast and Mitochondria gene family AT1G72820 62.606 6.52e-146 414.0
Soca5g04433 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 65.278 7.49e-34 108.0
Soca7g00289 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.194 0.0 501.0
Soca7g00288 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.194 0.0 501.0
Soca7g05024 . 19 345 Chloroplast and Mitochondria gene family AT1G72820 70.031 2.10e-163 459.0
Soca7g04209 . 35 255 Chloroplast and Mitochondria gene family AT3G61470 51.584 1.06e-74 226.0
Soca7g04603 ACH 5 367 Chloroplast and Mitochondria gene family AT5G14040 71.074 0.0 514.0
Soca3g05839 . 37 327 Chloroplast and Mitochondria gene family AT1G76570 77.663 6.56e-177 491.0
Soca4g04449 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.991 3.84e-150 418.0
Soca2g06010 . 1 146 Chloroplast and Mitochondria gene family AT1G07020 42.484 2.03e-25 93.2
Soca5g04809 . 168 265 Chloroplast and Mitochondria gene family AT2G05070 85.714 1.20e-57 176.0
Soca5g04817 . 59 267 Chloroplast and Mitochondria gene family AT1G29930 90.909 4.78e-140 390.0
Soca5g04815 . 59 267 Chloroplast and Mitochondria gene family AT1G29910 91.866 1.20e-140 392.0
Soca5g04816 . 59 267 Chloroplast and Mitochondria gene family AT1G29930 90.431 1.74e-139 389.0
Soca5g04801 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 86.94 1.09e-168 465.0
Soca5g04802 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 86.567 3.33e-168 464.0
Soca1g04370 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 84.583 8.43e-148 410.0
Soca1g05569 . 228 270 Chloroplast and Mitochondria gene family AT4G03320 53.488 1.01e-11 58.5
Soca1g05570 . 141 235 Chloroplast and Mitochondria gene family AT4G03320 35.789 1.08e-12 60.5
Soca1g05552 . 114 272 Chloroplast and Mitochondria gene family AT4G03320 40.491 1.50e-37 128.0
Soca1g05550 . 205 271 Chloroplast and Mitochondria gene family AT4G03320 47.761 3.59e-16 68.6
Soca1g05535 . 142 271 Chloroplast and Mitochondria gene family AT4G03320 42.105 4.47e-30 107.0
Soca6g01386 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 62.5 1.57e-32 105.0
Soca2g00711 ACH 1 342 Chloroplast and Mitochondria gene family AT1G72820 66.667 1.68e-156 440.0
Soca5g01272 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 88.06 8.12e-172 473.0
Soca5g01270 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 87.313 2.04e-170 469.0
Soca5g01271 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 87.313 2.04e-170 469.0
Soca6g01304 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 62.5 1.60e-32 105.0
Soca5g01900 . 51 255 Chloroplast and Mitochondria gene family AT3G61470 67.317 1.21e-101 295.0
Soca5g02321 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 3.57e-122 347.0
Soca5g02545 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 85.547 1.05e-160 445.0
Soca6g04123 ACH 1 364 Chloroplast and Mitochondria gene family AT5G14040 74.114 0.0 550.0
Soca9g00532 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 71.594 8.41e-171 477.0
Soca1g02915 . 1 187 Chloroplast and Mitochondria gene family AT1G17530 58.73 9.44e-67 201.0
Soca1g02914 . 1 187 Chloroplast and Mitochondria gene family AT1G17530 58.73 2.19e-66 199.0
Soca1g02718 . 44 403 Chloroplast and Mitochondria gene family AT2G28800 60.779 9.69e-155 448.0
Soca2g03656 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.171 2.26e-151 421.0
Soca2g02255 . 1 342 Chloroplast and Mitochondria gene family AT1G72820 66.374 3.26e-155 437.0
Soca1g03552 ACH 1 223 Chloroplast and Mitochondria gene family AT1G14730 59.193 3.39e-91 265.0
Soca1g03548 . 5 208 Chloroplast and Mitochondria gene family AT4G25570 44.878 4.66e-58 182.0
Soca1g03547 ACH 5 208 Chloroplast and Mitochondria gene family AT4G25570 44.878 4.66e-58 182.0
Soca1g03550 . 4 131 Chloroplast and Mitochondria gene family AT4G25570 51.938 3.10e-40 133.0
Soca1g03549 . 4 131 Chloroplast and Mitochondria gene family AT4G25570 51.938 3.10e-40 133.0
Soca1g03551 ACH 76 222 Chloroplast and Mitochondria gene family AT1G14730 46.259 5.49e-41 135.0
Soca1g03546 ACH 76 222 Chloroplast and Mitochondria gene family AT1G14730 46.259 5.49e-41 135.0
Soca7g04115 . 35 255 Chloroplast and Mitochondria gene family AT3G61470 51.584 1.13e-74 226.0
Soca7g02468 . 28 300 Chloroplast and Mitochondria gene family AT4G25700 70.144 1.80e-145 410.0
Soca8g04614 ACH 3 326 Chloroplast and Mitochondria gene family AT1G07030 68.196 4.16e-155 436.0
Soca8g04767 . 43 401 Chloroplast and Mitochondria gene family AT2G28800 82.271 0.0 612.0
Soca8g04566 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 65.278 2.25e-33 107.0
Soca8g03595 . 37 306 Chloroplast and Mitochondria gene family AT1G25380 27.019 3.22e-31 119.0
Soca8g03630 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.452 3.19e-166 462.0
Soca3g01514 ACH 5 373 Chloroplast and Mitochondria gene family AT5G14040 77.297 0.0 580.0
Soca3g01568 . 1 307 Chloroplast and Mitochondria gene family AT5G40810 85.668 0.0 510.0
Soca4g01676 . 48 101 Chloroplast and Mitochondria gene family AT2G05100 64.815 2.85e-17 77.4
Soca4g02100 . 41 318 Chloroplast and Mitochondria gene family AT1G07030 31.786 5.63e-33 122.0
Soca6g00090 . 1 181 Chloroplast and Mitochondria gene family AT3G08940 76.923 1.71e-92 267.0
Socaptg000381l_1g00089 . 37 303 Chloroplast and Mitochondria gene family AT1G25380 29.63 2.42e-13 68.2
Socaptg000381l_1g00424 . 1 273 Chloroplast and Mitochondria gene family AT1G61520 88.645 1.49e-172 475.0
Soca4g03147 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 2.88e-123 350.0
Soca4g03140 . 1 354 Chloroplast and Mitochondria gene family AT5G54290 67.127 1.08e-147 419.0
Soca4g03141 . 38 354 Chloroplast and Mitochondria gene family AT5G54290 73.817 9.74e-148 419.0
Soca4g03012 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 74.387 0.0 553.0
Soca4g02738 . 34 257 Chloroplast and Mitochondria gene family AT3G61470 52.232 1.62e-75 228.0
Soca4g01127 . 11 122 Chloroplast and Mitochondria gene family AT2G05100 61.607 8.33e-39 134.0
Soca4g01128 . 11 122 Chloroplast and Mitochondria gene family AT2G05100 61.607 1.32e-39 133.0
Soca8g04464 ACH 1 72 Chloroplast and Mitochondria gene family AT5G05370 65.278 2.25e-33 107.0
Soca5g04677 . 43 548 Chloroplast and Mitochondria gene family AT2G18710 83.794 0.0 849.0
Soca5g04517 . 1 131 Chloroplast and Mitochondria gene family AT1G29910 82.576 6.83e-73 217.0
Soca5g04514 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 85.821 1.88e-166 459.0
Soca5g04510 . 1 267 Chloroplast and Mitochondria gene family AT1G29910 86.194 1.54e-166 459.0
Soca7g03071 . 11 320 Chloroplast and Mitochondria gene family AT5G15640 76.452 0.0 502.0
Soca3g02235 . 29 300 Chloroplast and Mitochondria gene family AT2G47490 37.857 4.92e-47 159.0
Soca3g02233 . 29 180 Chloroplast and Mitochondria gene family AT2G47490 38.816 1.87e-23 93.2
Soca3g02234 . 29 180 Chloroplast and Mitochondria gene family AT2G47490 38.816 3.10e-23 93.2
Soca5g02755 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 86.719 3.98e-165 456.0
Soca5g02567 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 9.04e-122 346.0
Soca7g03712 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 84.286 1.43e-154 431.0
Soca7g03713 . 2 150 Chloroplast and Mitochondria gene family AT4G10340 78.0 2.93e-72 217.0
Soca7g03714 . 2 150 Chloroplast and Mitochondria gene family AT4G10340 77.333 1.25e-71 215.0
Soca7g03819 . 43 251 Chloroplast and Mitochondria gene family AT3G61470 47.642 4.60e-61 192.0
Soca4g03908 . 17 305 Chloroplast and Mitochondria gene family AT2G17270 69.204 1.80e-158 442.0
Soca3g03054 . 37 294 Chloroplast and Mitochondria gene family AT1G25380 30.0 4.76e-13 67.4
Socaptg000718l_1g00314 . 9 230 Chloroplast and Mitochondria gene family AT5G38630 66.368 1.02e-106 306.0
Soca2g04398 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 87.925 1.60e-178 490.0
Soca1g01677 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.967 3.19e-32 125.0
Soca9g01664 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.171 5.47e-151 419.0
Soca4g03532 . 1 124 Chloroplast and Mitochondria gene family AT1G26100 62.963 1.40e-49 157.0
Soca4g03587 ACH 10 241 Chloroplast and Mitochondria gene family AT1G25380 66.383 4.53e-100 295.0
Soca4g03435 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 75.269 0.0 560.0
Soca1g01505 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.967 9.18e-33 127.0
Soca1g01506 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.967 9.18e-33 127.0
Soca3g02489 . 98 165 Chloroplast and Mitochondria gene family AT2G17270 57.353 1.51e-17 80.9
Soca3g02488 . 7 305 Chloroplast and Mitochondria gene family AT2G17270 66.89 5.60e-153 429.0
Soca3g01918 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 69.298 6.28e-117 331.0
Soca2g04358 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.302 3.16e-179 491.0
Soca1g08551 . 114 272 Chloroplast and Mitochondria gene family AT4G03320 38.65 3.85e-36 125.0