AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Stre6g02066 ATGGCTTTCACAATTGCTTCCACCTCCCATTCATCCCTCCCAACCAGGGGAGAATTCACCACAAAACTACCTTCATCTGAAAGAAGTATCATTCCAAGAAACTTGATCAGAATCAACCATGGACAGAAACTGAAAGCAGGTAAAGAAGTATCAAGTGTCTGTGAACCACTTCCTGCCGACAGACCGGTCTGGTTTCCAGGAACCTCGCCTCCCGAATGGCTCGATGGCAGCCTCCCTGGAGATTTTGGCTTTGACCCACTCGGATTAGGGTCTGATCCAGAATTACTCAAATGGTTTGCTCAAGCTGAATTGATGCACAGCAGATGGGCAATGCTTGCAGTCGCGGGTATTTTGATCCCTGAATGGCTCGAAAGTTTGGGTTTTATCGACAATTTCTCGTGGTTCGAAGCGGGTTCTAGAGAATACTTTGCTGACCCGACCACTTTGTTTGTGGTTCAGTTAGCCTTGATGGGTTGGGTTGAGGGTCGAAGATGGGCTGACATCATTAACCCAGGGTGCGTTGACATTGAACCTAAACTTCCCAATAAGAAGAAACCAAAGCCCGATGTTGGGTACCCGGGTGGCTTGTGGTTCGACCCGTTTATGTGGGGAAGAGGGTCGCCAGAAACCGGTTATGGTTTTGAGGACTAA 651 48.39 MAFTIASTSHSSLPTRGEFTTKLPSSERSIIPRNLIRINHGQKLKAGKEVSSVCEPLPADRPVWFPGTSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWLESLGFIDNFSWFEAGSREYFADPTTLFVVQLALMGWVEGRRWADIINPGCVDIEPKLPNKKKPKPDVGYPGGLWFDPFMWGRGSPETGYGFED 216
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Stre6g02066 216 SUPERFAMILY Chlorophyll a-b binding protein 60 209 - -
Stre6g02066 216 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 42 209 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Stre6g02066 216 MobiDBLite consensus disorder prediction 1 23 - -
Stre6g02066 216 Pfam Chlorophyll A-B binding protein 70 210 IPR022796 -
Stre6g02066 216 Gene3D Chlorophyll a-b binding protein domain 71 212 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Stre6g02066 K08908 light-harvesting complex I chlorophyll a/b binding protein 2
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Stre Stre-Chr2:14853941 Stre6g02066 Stre-Chr6:79073997 dispersed
Stre Stre-Chr4:104337492 Stre6g02066 Stre-Chr6:79073997 dispersed
Stre Stre-Chr6:79073997 Stre9g03030 Stre-Chr9:98105355 dispersed
Stre Stre-Chr6:79073997 Stre2g00716 Stre-Chr2:14811565 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Stre9g01622 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 87.5 8.76e-166 458.0
Stre9g01197 . 68 548 Chloroplast and Mitochondria gene family AT2G18710 74.689 0.0 707.0
Stre9g02119 . 1 367 Chloroplast and Mitochondria gene family AT5G14040 75.135 0.0 550.0
Stre9g03030 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 80.695 1.26e-145 406.0
Stre9g02114 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 75.472 0.0 548.0
Stre9g01286 WGDA 1 72 Chloroplast and Mitochondria gene family AT5G05370 61.111 1.74e-29 97.8
Stre9g01206 . 68 548 Chloroplast and Mitochondria gene family AT2G18710 83.368 0.0 818.0
Stre1g01096 WGDA 33 294 Chloroplast and Mitochondria gene family AT1G25380 27.875 1.65e-13 68.2
Stre1g04761 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 68.598 3.40e-160 449.0
Stre1g01672 . 54 390 Chloroplast and Mitochondria gene family AT4G21490 22.283 4.55e-06 47.4
Stre1g02045 . 193 266 Chloroplast and Mitochondria gene family AT2G34430 91.892 3.38e-44 141.0
Stre1g04320 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 76.948 4.40e-164 457.0
Stre1g00064 . 1 215 Chloroplast and Mitochondria gene family AT4G25570 70.698 1.12e-107 308.0
Stre1g02579 . 1 329 Chloroplast and Mitochondria gene family AT2G30160 70.393 1.55e-162 455.0
Stre1g01417 ACH,WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 36.429 5.74e-46 156.0
Stre1g04297 . 152 300 Chloroplast and Mitochondria gene family AT2G47490 36.774 7.96e-23 91.3
Stre1g02575 . 73 329 Chloroplast and Mitochondria gene family AT2G30160 72.201 7.40e-126 359.0
Stre1g04750 . 1 327 Chloroplast and Mitochondria gene family AT2G30160 68.598 3.40e-160 449.0
Stre1g02303 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.117 9.21e-157 437.0
Stre1g02044 . 1 183 Chloroplast and Mitochondria gene family AT1G29910 79.235 2.80e-99 288.0
Stre1g02308 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.117 9.21e-157 437.0
Stre1g04852 . 51 410 Chloroplast and Mitochondria gene family AT2G28800 80.939 0.0 595.0
Stre10g00460 . 104 271 Chloroplast and Mitochondria gene family AT4G03320 40.462 5.22e-41 140.0
Stre11g02567 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.058 2.52e-166 466.0
Stre11g02571 ACH,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 70.058 2.52e-166 466.0
Stre11g02096 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.821 8.80e-169 465.0
Stre11g02090 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.94 2.78e-169 466.0
Stre11g01943 . 1 303 Chloroplast and Mitochondria gene family AT2G17270 64.356 1.03e-151 425.0
Stre11g01913 . 1 303 Chloroplast and Mitochondria gene family AT2G17270 67.327 1.17e-161 451.0
Stre11g02145 . 1 263 Chloroplast and Mitochondria gene family AT1G29930 88.258 3.16e-163 462.0
Stre11g02091 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 87.313 3.85e-167 461.0
Stre11g01665 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 76.613 0.0 572.0
Stre11g02144 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.313 4.51e-169 466.0
Stre11g02147 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.821 5.74e-169 466.0
Stre11g00464 ACH,WGDA 4 211 Chloroplast and Mitochondria gene family AT4G25570 44.712 8.88e-61 189.0
Stre11g00602 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.142 2.82e-170 469.0
Stre11g02094 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 2.81e-170 469.0
Stre4g01618 . 1 320 Chloroplast and Mitochondria gene family AT5G15640 71.25 2.28e-174 484.0
Stre4g02250 . 35 255 Chloroplast and Mitochondria gene family AT3G61470 50.679 6.64e-73 221.0
Stre4g01984 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 79.004 2.86e-140 394.0
Stre4g00940 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.891 2.10e-169 467.0
Stre4g01981 . 2 280 Chloroplast and Mitochondria gene family AT4G10340 79.004 2.86e-140 394.0
Stre4g01617 ACH 12 321 Chloroplast and Mitochondria gene family AT5G15640 71.975 1.76e-170 474.0
Stre4g02746 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.887 5.54e-176 491.0
Stre4g02730 . 1 345 Chloroplast and Mitochondria gene family AT1G72820 67.606 4.04e-174 486.0
Stre4g02054 . 52 254 Chloroplast and Mitochondria gene family AT3G61470 49.515 2.85e-62 195.0
Stre4g00977 . 1 265 Chloroplast and Mitochondria gene family AT1G29930 86.792 4.30e-168 464.0
Stre4g02478 ACH 1 361 Chloroplast and Mitochondria gene family AT5G14040 70.637 1.82e-180 503.0
Stre4g01317 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 58.442 6.15e-108 311.0
Stre2g04200 . 28 300 Chloroplast and Mitochondria gene family AT4G25700 70.833 8.92e-145 408.0
Stre2g05634 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 54.726 1.84e-74 225.0
Stre2g00024 . 9 236 Chloroplast and Mitochondria gene family AT1G26100 59.542 1.58e-86 255.0
Stre2g03686 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 87.925 1.11e-178 490.0
Stre2g00707 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.541 4.62e-149 415.0
Stre2g05635 . 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 3.67e-75 227.0
Stre2g00708 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.09 3.32e-148 413.0
Stre2g00717 . 33 254 Chloroplast and Mitochondria gene family AT3G61470 90.09 3.32e-148 413.0
Stre2g00716 . 45 254 Chloroplast and Mitochondria gene family AT3G61470 93.333 5.26e-148 412.0
Stre2g03282 ACH 1 258 Chloroplast and Mitochondria gene family AT1G15820 79.845 1.23e-148 414.0
Stre2g06078 . 70 354 Chloroplast and Mitochondria gene family AT5G54290 79.298 8.89e-145 412.0
Stre2g06148 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 70.845 0.0 541.0
Stre2g04459 ACH,WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.365 0.0 502.0
Stre8g02267 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 82.083 1.42e-144 402.0
Stre8g03124 ACH 4 214 Chloroplast and Mitochondria gene family AT4G25570 41.232 9.56e-59 183.0
Stre8g02512 . 72 407 Chloroplast and Mitochondria gene family AT2G28800 62.011 2.64e-155 450.0
Stre8g02500 . 72 407 Chloroplast and Mitochondria gene family AT2G28800 62.011 1.88e-155 449.0
Stre8g03125 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 59.375 1.30e-91 266.0
Stre8g02982 WGDA 33 308 Chloroplast and Mitochondria gene family AT1G25380 62.007 5.56e-120 348.0
Stre8g00064 . 156 287 Chloroplast and Mitochondria gene family AT5G01530 87.121 1.57e-79 234.0
Stre8g00034 . 156 197 Chloroplast and Mitochondria gene family AT5G01530 88.095 3.18e-20 78.2
Stre8g02282 . 1 213 Chloroplast and Mitochondria gene family AT3G54890 80.841 1.50e-122 346.0
Stre3g02432 ACH 2 272 Chloroplast and Mitochondria gene family AT5G14040 71.956 1.73e-137 390.0
Stre3g02227 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 61.842 1.11e-99 286.0
Stre3g01399 ACH 1 343 Chloroplast and Mitochondria gene family AT1G72820 67.052 1.43e-155 438.0
Stre3g02166 . 1 228 Chloroplast and Mitochondria gene family AT5G38630 62.661 1.77e-104 300.0
Stre3g01187 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.302 6.95e-180 493.0
Stre3g02365 ACH 109 307 Chloroplast and Mitochondria gene family AT5G40810 93.467 4.74e-124 351.0
Stre3g01186 . 1 264 Chloroplast and Mitochondria gene family AT2G05100 88.636 6.96e-178 490.0
Stre5g01443 . 12 316 Chloroplast and Mitochondria gene family AT1G07030 29.487 2.09e-31 122.0
Stre5g00798 . 1 239 Chloroplast and Mitochondria gene family AT3G54890 73.75 2.77e-122 345.0
Stre5g00418 WGDA 33 327 Chloroplast and Mitochondria gene family AT1G25380 65.781 2.05e-143 408.0
Stre5g02259 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.416 1.12e-122 348.0
Stre5g02260 . 2 265 Chloroplast and Mitochondria gene family AT2G05100 58.647 6.90e-98 284.0
Stre5g03028 ACH,WGDA 99 343 Chloroplast and Mitochondria gene family AT1G72820 66.667 2.81e-104 304.0
Stre5g02927 . 4 187 Chloroplast and Mitochondria gene family AT1G17530 61.413 9.00e-71 211.0
Stre7g02013 ACH,WGDA 29 236 Chloroplast and Mitochondria gene family AT2G47490 35.714 2.91e-29 110.0
Stre7g01657 . 42 325 Chloroplast and Mitochondria gene family AT1G76570 74.49 5.40e-166 463.0
Stre7g01928 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.06 7.89e-171 470.0
Stre7g02534 . 33 294 Chloroplast and Mitochondria gene family AT2G47490 28.62 7.15e-28 108.0
Stre7g00471 ACH,WGDA 6 224 Chloroplast and Mitochondria gene family AT5G38630 37.9 3.35e-47 154.0
Stre6g02066 . 51 199 Chloroplast and Mitochondria gene family AT3G61470 67.785 9.38e-73 219.0
Stre6g02983 . 6 267 Chloroplast and Mitochondria gene family AT1G29930 81.679 5.33e-149 414.0
Stre6g03181 . 12 201 Chloroplast and Mitochondria gene family AT1G07030 26.042 7.30e-15 73.9
Stre6g01043 . 8 143 Chloroplast and Mitochondria gene family AT1G07020 46.377 1.61e-26 95.9
Stre6g02982 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.687 1.07e-170 470.0
Stre6g01256 WGDA 1 72 Chloroplast and Mitochondria gene family AT5G05370 68.056 6.77e-35 111.0
Stre6g00369 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.672 2.88e-169 467.0
Stre6g01245 . 68 233 Chloroplast and Mitochondria gene family AT1G72820 51.205 2.43e-39 134.0