AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Taer4g02335 ATGTCGAACGCCGTCGTCAATGGCCTCGCCGGAGCCGGCGGAGGTATAATTGCTCAAATCATCACATATCCTCTTCAATCGGTGAACACGCGTCAACAGACGGAGAGAATCGCAAAGAAGTCTCGATCTCAGGGATCATCTGGCGGTACACTTGTTCAATTAATTGAGGTTATACGAAGCGAAGGAATTGGAGGATTATACAGTGGACTTAAACCTTCTTTGCTTGGAACTGCTGCATCACAGGGGATTTATTATTATTTTTATCAGGTTTTTAAAAATAAAGCGGAGTCTATTGCAGCATTGAATAAACGAAAGGGTCGTGGAGATGGTACAGTTGGTATGTTCTCCTGGCTTGTTGTGGCTGCTTTAGCTGGGTCATTGAATGTACTGTTTACAAACCCAATTTGGGTGCTTGTGACCCGTATGCAGACACACACACAAGCAGAACAGAAGATTCTAGAAGCAAAGAAGGAAGCTATGTTAAGAGAATGTTCTGAAAGCAATATGGTTGGTTCTTCTTTGCATGATAAGTTGCGTGAGCTCGATTCAGTGAAGCCTAATCCTTATGGGACATTGCAGGCGGCAAAGGAGGTTTATAACGAAGCTGGAGTAAAGGGATTTTGGAAAGGGATTGTTCCTACTATGATCATGGTATGCAACCCATCAATACAATTCATGATTTATGAGACGTCTCTAAAGTACTTGAGGTCTAAACGTGCTGAGAAGAAGCAAAGTTCAAATAAAGTTTCTGCTTGGGAGGTATTTATAGTAGGGGCCATTGCTAAACTTGGAGCAACTGTGACAACTTACCCTTTGTTAGTTGTAAAGTCAAGACTTCAAGCAAAGCAAGAAATCAGTAAAAACAATTCTTTGAGATATTCAGGTACCTTGGATGCAATTGTGAAGATGATTCATTATGAAGGATTATCATGCTTCTACAAAGGTATGAGCACCAAGATAGTACAGAGTGTATTTGCAGCCTCTGTACTTTTCATGATCAAAGAAGAGCTGGTTAACTTTTTTGAAATGTTAGCAAAGAAGAGCCAAAAGATAGTATTAAAAATGTCAACTTAA 1074 40.32 MSNAVVNGLAGAGGGIIAQIITYPLQSVNTRQQTERIAKKSRSQGSSGGTLVQLIEVIRSEGIGGLYSGLKPSLLGTAASQGIYYYFYQVFKNKAESIAALNKRKGRGDGTVGMFSWLVVAALAGSLNVLFTNPIWVLVTRMQTHTQAEQKILEAKKEAMLRECSESNMVGSSLHDKLRELDSVKPNPYGTLQAAKEVYNEAGVKGFWKGIVPTMIMVCNPSIQFMIYETSLKYLRSKRAEKKQSSNKVSAWEVFIVGAIAKLGATVTTYPLLVVKSRLQAKQEISKNNSLRYSGTLDAIVKMIHYEGLSCFYKGMSTKIVQSVFAASVLFMIKEELVNFFEMLAKKSQKIVLKMST* 358
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Taer4g02335 357 ProSiteProfiles Solute carrier (Solcar) repeat profile. 112 234 IPR018108 -
Taer4g02335 357 SUPERFAMILY Mitochondrial carrier 3 336 IPR023395 -
Taer4g02335 357 PANTHER MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED 3 351 IPR044712 GO:0006862(InterPro)|GO:0022857(PANTHER)|GO:0055085(PANTHER)|GO:0055085(InterPro)
Taer4g02335 357 Gene3D Mitochondrial carrier domain 2 341 IPR023395 -
Taer4g02335 357 ProSiteProfiles Solute carrier (Solcar) repeat profile. 249 340 IPR018108 -
Taer4g02335 357 ProSiteProfiles Solute carrier (Solcar) repeat profile. 2 94 IPR018108 -
Taer4g02335 357 Pfam Mitochondrial carrier protein 189 238 IPR018108 -
Taer4g02335 357 Pfam Mitochondrial carrier protein 4 93 IPR018108 -
Taer4g02335 357 Pfam Mitochondrial carrier protein 248 341 IPR018108 -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Taer4g02335 K13354 solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
5254785 Taer Taer4g02335 Taer-Chr4:53332964 Taer4g02369 Taer-Chr4:53834884
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Taer1g01428 WGDA 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 2.52e-122 351.0
Taer1g01596 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 8.20e-75 226.0
Taer1g02406 . 93 254 Chloroplast and Mitochondria gene family AT3G61470 74.074 2.51e-80 239.0
Taer1g03419 . 1 227 Chloroplast and Mitochondria gene family AT1G26100 61.135 6.02e-84 248.0
Taer1g03423 . 1 227 Chloroplast and Mitochondria gene family AT1G26100 61.135 4.74e-84 248.0
Taer1g03948 WGDA 45 254 Chloroplast and Mitochondria gene family AT3G61470 95.238 1.35e-150 419.0
Taer1g04318 . 84 354 Chloroplast and Mitochondria gene family AT2G28800 20.069 1.05e-07 52.4
Taer1g04772 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 64.035 2.88e-107 307.0
Taer1g05541 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.672 3.18e-172 474.0
Taer1g06404 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 38.246 4.88e-50 166.0
Taer1g06766 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 83.226 1.23e-177 495.0
Taer1g06767 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 83.226 8.14e-179 497.0
Taer1g06804 ACH 6 373 Chloroplast and Mitochondria gene family AT5G14040 78.804 0.0 577.0
Taer1g07386 . 1 301 Chloroplast and Mitochondria gene family AT4G25700 64.353 1.32e-144 408.0
Taer2g02118 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 73.885 3.13e-178 494.0
Taer2g02119 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 70.701 1.22e-170 474.0
Taer2g02584 WGDA 3 280 Chloroplast and Mitochondria gene family AT4G10340 83.63 8.72e-155 431.0
Taer2g02678 . 38 254 Chloroplast and Mitochondria gene family AT3G61470 45.0 1.16e-58 186.0
Taer2g03159 ACH 1 365 Chloroplast and Mitochondria gene family AT5G14040 69.399 0.0 506.0
Taer2g03420 . 5 345 Chloroplast and Mitochondria gene family AT1G72820 66.959 5.92e-169 473.0
Taer4g00939 . 1 328 Chloroplast and Mitochondria gene family AT2G30160 71.299 5.30e-167 466.0
Taer4g00962 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 63.889 6.92e-31 104.0
Taer4g01028 . 38 270 Chloroplast and Mitochondria gene family AT4G03320 35.443 1.70e-41 143.0
Taer4g02335 . 37 309 Chloroplast and Mitochondria gene family AT1G25380 26.769 1.08e-30 118.0
Taer4g02369 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 77.922 5.77e-167 464.0
Taer4g02969 . 50 405 Chloroplast and Mitochondria gene family AT2G28800 82.451 0.0 600.0
Taer5g00315 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 77.239 2.20e-142 397.0
Taer5g00316 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.821 4.00e-169 467.0
Taer5g00317 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 86.94 1.32e-170 470.0
Taer5g00475 ACH 1 303 Chloroplast and Mitochondria gene family AT2G17270 66.997 2.16e-160 447.0
Taer5g00691 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 77.419 0.0 574.0
Taer5g02876 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 9.68e-171 470.0
Taer5g03006 WGDA 6 224 Chloroplast and Mitochondria gene family AT5G38630 39.269 1.25e-53 170.0
Taer6g00431 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 1.14e-173 478.0
Taer6g01118 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 65.217 9.98e-100 293.0
Taer6g01571 . 47 548 Chloroplast and Mitochondria gene family AT2G18710 82.051 0.0 835.0
Taer6g03832 WGDA 1 280 Chloroplast and Mitochondria gene family AT4G10340 83.688 2.74e-148 414.0
Taer6g03931 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 65.217 1.98e-100 292.0
Taer7g00402 ACH,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.942 1.45e-169 474.0
Taer7g01015 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.171 8.20e-152 422.0
Taer7g01550 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.302 6.30e-179 491.0
Taer7g01551 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.302 3.12e-179 491.0
Taer7g01729 ACH 6 343 Chloroplast and Mitochondria gene family AT1G72820 67.353 1.02e-151 428.0
Taer7g03473 . 33 327 Chloroplast and Mitochondria gene family AT1G25380 66.445 9.79e-143 406.0
Taer8g00329 ACH,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.388 7.34e-166 467.0
Taer8g00430 . 1 187 Chloroplast and Mitochondria gene family AT1G17530 61.497 8.69e-72 213.0
Taer8g02034 . 72 407 Chloroplast and Mitochondria gene family AT2G28800 63.128 6.54e-157 454.0
Taer8g02543 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 58.036 1.23e-90 264.0
Taer9g00669 WGDA 4 211 Chloroplast and Mitochondria gene family AT4G25570 39.423 1.45e-54 173.0
Taer9g00757 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 4.43e-170 468.0
Taer9g01216 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.482 6.29e-159 442.0
Taer9g02530 . 2 364 Chloroplast and Mitochondria gene family AT5G14040 72.922 0.0 546.0
Taer10g00078 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 63.598 2.24e-107 308.0
Taer10g00988 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.365 0.0 506.0
Taer10g00996 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.365 0.0 505.0
Taer10g01182 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.982 8.32e-116 328.0
Taer10g01385 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 38.929 1.76e-50 168.0
Taer10g01659 . 33 294 Chloroplast and Mitochondria gene family AT1G25380 26.95 1.14e-12 66.2
Taer11g00389 . 1 354 Chloroplast and Mitochondria gene family AT5G54290 69.274 1.33e-148 421.0
Taer11g00460 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 71.117 0.0 538.0
Taer11g00635 WGDA 55 250 Chloroplast and Mitochondria gene family AT3G61470 57.653 1.71e-75 229.0
Taer11g02420 WGDA 32 254 Chloroplast and Mitochondria gene family AT3G61470 91.031 4.49e-151 420.0
Taer12g00849 . 40 325 Chloroplast and Mitochondria gene family AT1G76570 76.923 2.10e-168 469.0