AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Taer4g02381 ATGCAAGACCAAATCGAGAACTCGAATTCGGTACCAGCCTCCGCCGTCGTCATGGGTATCGATCTTGTTGCCGGTGGTAAAAGCAAACGAACCAAAAGAACCGCCCCTAGATCCGATGATATCTACCTCAAACTCCTTGTCAAGCTGTATCGGTTTTTGGTGAGGAGGACTGGAAGCAACTTCAATGCTGTGATTTTGAAGAGGCTGTTTATGAGCAAAGTTAACAAGCCTCCGATTTCACTCTCTCGTTTGATTCGTTATATTTCTGGAAAGGAGGACAAGATTGCTGTGGTTGTGGGAACAGTTACAGATGATGTGAGGGTGCATGAAATCCCTTGTTTGAAAGTGACTGCATTGAGGTTTACGGAGACCGCAAGGGCGAGGATTGAGAAAGCAGGCGGAGAATGTTTGACTTTTGATCAGCTGGCTCTTCGAGCTCCTCTTGGACAGAACACTGTTCTTCTTAGAGGTCCAAAGAACTCTCGTGAAGCAGTGAGGCACTTCGGTAAGGCTCCTGGTGTACCACACAGTCACACTAAGCCGTACGTGAGATCTAAGGGAAGGAAGTTTGAGAAGGCCCGAGGTAGAAGAAACAGCAGAGGATTTAGAAACTAA 615 46.99 MQDQIENSNSVPASAVVMGIDLVAGGKSKRTKRTAPRSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKPPISLSRLIRYISGKEDKIAVVVGTVTDDVRVHEIPCLKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVRHFGKAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRN* 205
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Taer4g02381 204 MobiDBLite consensus disorder prediction 168 204 - -
Taer4g02381 204 MobiDBLite consensus disorder prediction 181 204 - -
Taer4g02381 204 SUPERFAMILY Ribosomal proteins L15p and L18e 38 156 IPR036227 -
Taer4g02381 204 Gene3D - 18 204 - -
Taer4g02381 204 Pfam Ribosomal protein 60S L18 and 50S L18e 19 203 IPR021131 -
Taer4g02381 204 PANTHER 60S RIBOSOMAL PROTEIN L18 18 204 IPR000039 GO:0003723(PANTHER)|GO:0003735(PANTHER)|GO:0003735(InterPro)|GO:0005840(InterPro)|GO:0006412(InterPro)|GO:0022625(PANTHER)
Taer4g02381 204 FunFam 60S ribosomal protein L18 18 204 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Taer4g02381 K02883 large subunit ribosomal protein L18e
leaf

Event-related genes

Select Gene_1 Gene_2 Event_name
161924 Taer1g03015 Taer4g02381
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
5246617 Taer Taer1g03015 Taer-Chr1:33769541 Taer4g02381 Taer-Chr4:53983868
5288675 Taer Taer4g00787 Taer-Chr4:5989886 Taer4g02381 Taer-Chr4:53983868
5289033 Taer Taer4g02381 Taer-Chr4:53983868 Taer6g00780 Taer-Chr6:5315844
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Taer1g00360 . 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 90.84 0.0 505.0
Taer1g00495 . 1 292 Cytoplasmic Ribosomal Protein gene family AT5G39740 83.219 0.0 510.0
Taer1g00676 . 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 7.05e-95 279.0
Taer1g00708 WGDA 1 137 Cytoplasmic Ribosomal Protein gene family AT5G04800 81.429 4.14e-77 226.0
Taer1g00779 ACH,WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 7.70e-101 287.0
Taer1g00816 . 17 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 84.817 1.11e-124 350.0
Taer1g00847 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 68.696 1.15e-31 107.0
Taer1g00904 ACH 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 88.554 3.13e-107 301.0
Taer1g01078 . 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 5.79e-69 201.0
Taer1g01280 WGDA 53 386 Cytoplasmic Ribosomal Protein gene family AT1G43170 88.623 0.0 612.0
Taer1g01365 . 1 209 Cytoplasmic Ribosomal Protein gene family AT5G59240 86.175 1.12e-126 355.0
Taer1g01420 WGDA 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 91.86 1.57e-180 496.0
Taer1g01453 . 1 210 Cytoplasmic Ribosomal Protein gene family AT5G59240 86.239 2.63e-127 357.0
Taer1g01461 WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 8.80e-64 191.0
Taer1g01527 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 86.986 2.04e-92 266.0
Taer1g01576 . 1 119 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.597 1.14e-68 220.0
Taer1g01652 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.938 7.42e-172 474.0
Taer1g01779 ACH,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.77 2.12e-117 333.0
Taer1g01860 WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 88.421 1.45e-57 174.0
Taer1g02296 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.549 2.67e-168 466.0
Taer1g02449 . 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 78.761 5.55e-62 184.0
Taer1g02451 WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 85.185 1.54e-50 152.0
Taer1g02562 . 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 3.24e-64 193.0
Taer1g02636 . 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 83.645 2.57e-125 353.0
Taer1g02715 ACH,WGDA 7 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 81.673 8.59e-152 425.0
Taer1g02789 . 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 2.27e-144 403.0
Taer1g02793 . 193 222 Cytoplasmic Ribosomal Protein gene family AT2G44120 76.667 5.63e-11 55.5
Taer1g02852 ACH 1 105 Cytoplasmic Ribosomal Protein gene family AT5G59850 91.429 2.26e-68 201.0
Taer1g02932 WGDA 1 260 Cytoplasmic Ribosomal Protein gene family AT5G58420 90.0 0.0 496.0
Taer1g02998 . 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 84.689 4.45e-126 352.0
Taer1g03015 ACH 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 84.409 9.29e-117 327.0
Taer1g03017 ACH 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 83.333 7.73e-62 183.0
Taer1g03070 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 7.06e-84 243.0
Taer1g03071 ACH 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 1.65e-107 303.0
Taer1g03127 . 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Taer1g03374 . 1 119 Cytoplasmic Ribosomal Protein gene family AT5G56710 82.5 2.13e-70 204.0
Taer1g03545 WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Taer1g03688 WGDA 1 250 Cytoplasmic Ribosomal Protein gene family AT2G31610 85.375 1.91e-146 425.0
Taer1g03906 ACH 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 94.186 5.54e-59 175.0
Taer1g03958 . 1 75 Cytoplasmic Ribosomal Protein gene family AT3G52590 56.0 1.36e-21 87.4
Taer1g04213 ACH 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 92.754 1.91e-43 134.0
Taer1g04284 ACH 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Taer1g04286 . 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.405 1.61e-163 452.0
Taer1g04448 ACH 1 72 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.278 1.97e-10 57.8
Taer1g04748 . 64 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 31.683 1.29e-09 53.5
Taer1g04899 ACH 1 141 Cytoplasmic Ribosomal Protein gene family AT3G49910 84.397 2.71e-83 239.0
Taer1g04914 WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 76.44 3.37e-111 313.0
Taer1g05762 . 5 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 85.211 1.75e-90 257.0
Taer1g05894 . 70 129 Cytoplasmic Ribosomal Protein gene family AT5G09490 46.667 3.86e-12 57.4
Taer1g06004 ACH 1 57 Cytoplasmic Ribosomal Protein gene family AT3G52590 33.333 1.21e-06 45.8
Taer1g06204 . 1 390 Cytoplasmic Ribosomal Protein gene family AT1G61580 86.923 0.0 701.0
Taer1g06301 . 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 1.03e-49 151.0
Taer1g06346 WGDA 3 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 30.882 1.65e-07 48.5
Taer1g06452 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.132 6.46e-82 236.0
Taer1g06790 ACH 1 63 Cytoplasmic Ribosomal Protein gene family AT5G64140 90.625 3.83e-35 112.0
Taer1g06820 . 30 124 Cytoplasmic Ribosomal Protein gene family AT3G04400 38.384 2.64e-10 53.9
Taer1g06844 . 93 118 Cytoplasmic Ribosomal Protein gene family AT4G34670 84.615 3.04e-09 50.8
Taer1g07198 . 36 82 Cytoplasmic Ribosomal Protein gene family AT2G20450 59.574 1.39e-10 53.1
Taer1g07351 . 4 288 Cytoplasmic Ribosomal Protein gene family AT2G40010 79.649 4.05e-171 475.0
Taer1g07385 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 1.43e-83 243.0
Taer1g07445 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 4.02e-126 352.0
Taer1g07462 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 66.379 3.48e-45 140.0
Taer1g07578 . 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 79.259 7.89e-80 229.0
Taer2g00145 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 87.963 1.72e-52 161.0
Taer2g00179 ACH 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.0 2.12e-80 231.0
Taer2g00335 . 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 90.686 1.56e-126 353.0
Taer2g00399 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 63.559 1.04e-45 141.0
Taer2g00547 . 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.815 4.92e-130 363.0
Taer2g00555 . 71 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 33.813 4.04e-11 57.0
Taer2g00603 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 80.769 7.07e-84 244.0
Taer2g01377 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 91.566 1.59e-166 458.0
Taer2g01569 ACH 3 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 79.703 0.0 661.0
Taer2g01847 ACH 1 62 Cytoplasmic Ribosomal Protein gene family AT5G64140 92.063 2.34e-35 113.0
Taer2g01885 . 4 316 Cytoplasmic Ribosomal Protein gene family AT2G40010 77.215 1.52e-176 489.0
Taer2g02088 . 1 143 Cytoplasmic Ribosomal Protein gene family AT3G02080 83.916 3.24e-90 256.0
Taer2g02414 ACH 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 80.795 2.33e-83 239.0
Taer2g02539 . 9 211 Cytoplasmic Ribosomal Protein gene family AT2G27530 25.238 2.16e-06 46.6
Taer2g02831 ACH 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.549 4.74e-171 470.0
Taer2g02877 . 3 140 Cytoplasmic Ribosomal Protein gene family AT5G61170 89.13 1.18e-92 263.0
Taer2g02960 WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 77.487 4.68e-110 313.0
Taer2g03038 ACH 38 146 Cytoplasmic Ribosomal Protein gene family AT1G23290 82.569 1.21e-64 190.0
Taer2g03104 WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.286 6.54e-120 334.0
Taer2g03191 WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 44.595 2.22e-08 50.4
Taer2g03217 . 1 247 Cytoplasmic Ribosomal Protein gene family AT1G80750 57.2 5.36e-90 273.0
Taer2g03383 ACH 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 72.028 2.17e-72 215.0
Taer3g00210 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 66.667 2.29e-33 112.0
Taer3g00247 ACH 18 207 Cytoplasmic Ribosomal Protein gene family AT3G11940 85.789 2.02e-124 351.0
Taer3g00256 . 64 164 Cytoplasmic Ribosomal Protein gene family AT5G15200 30.693 7.56e-09 51.2
Taer3g00279 WGDA 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.927 5.44e-101 286.0
Taer3g00340 WGDA 1 141 Cytoplasmic Ribosomal Protein gene family AT5G04800 79.333 2.45e-78 227.0
Taer3g00393 ACH 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 7.16e-94 278.0
Taer3g00942 . 61 168 Cytoplasmic Ribosomal Protein gene family AT5G39850 59.259 2.53e-37 124.0
Taer3g01189 . 1 137 Cytoplasmic Ribosomal Protein gene family AT5G04800 81.429 2.15e-77 224.0
Taer3g01501 . 108 215 Cytoplasmic Ribosomal Protein gene family AT3G51190 46.296 8.47e-21 83.2
Taer3g01525 . 106 148 Cytoplasmic Ribosomal Protein gene family AT5G39850 48.837 3.12e-06 44.3
Taer3g01540 . 70 136 Cytoplasmic Ribosomal Protein gene family AT3G04400 35.294 2.80e-08 45.4
Taer3g01653 . 21 213 Cytoplasmic Ribosomal Protein gene family AT3G11250 20.202 1.25e-10 58.5
Taer3g01919 WGDA 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 88.356 5.46e-93 264.0
Taer3g02122 WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 84.733 2.47e-162 450.0
Taer3g02614 ACH,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 83.246 1.22e-118 333.0
Taer3g02847 WGDA 21 117 Cytoplasmic Ribosomal Protein gene family AT3G47370 31.633 1.28e-07 46.6
Taer3g03193 ACH 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 82.158 1.60e-149 415.0
Taer4g00022 WGDA 1 193 Cytoplasmic Ribosomal Protein gene family AT4G10450 81.347 3.70e-118 331.0
Taer4g00060 . 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 87.368 5.30e-57 169.0
Taer4g00260 . 1 137 Cytoplasmic Ribosomal Protein gene family AT5G04800 83.453 1.52e-79 231.0
Taer4g00279 ACH 17 207 Cytoplasmic Ribosomal Protein gene family AT2G37270 84.817 2.27e-123 348.0
Taer4g00294 WGDA 3 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.72 3.73e-126 358.0
Taer4g00300 ACH 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 71.681 7.47e-35 115.0
Taer4g00348 ACH,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 88.554 1.50e-107 303.0
Taer4g00593 . 62 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 73.077 1.87e-21 83.2
Taer4g00667 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 81.545 5.85e-124 351.0
Taer4g00713 . 1 142 Cytoplasmic Ribosomal Protein gene family AT5G02960 95.775 3.11e-96 271.0
Taer4g00739 . 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Taer4g00787 . 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.559 7.60e-121 337.0
Taer4g00792 . 1 209 Cytoplasmic Ribosomal Protein gene family AT3G16780 85.714 1.14e-127 357.0
Taer4g00831 . 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 6.19e-99 278.0
Taer4g00838 . 1 131 Cytoplasmic Ribosomal Protein gene family AT4G27090 87.786 3.49e-80 230.0
Taer4g00951 . 1 110 Cytoplasmic Ribosomal Protein gene family AT3G56340 80.909 6.74e-61 183.0
Taer4g00960 . 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 4.80e-145 402.0
Taer4g00973 . 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 82.192 0.0 502.0
Taer4g00988 . 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 85.714 2.41e-84 241.0
Taer4g01184 . 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 93.443 9.44e-82 234.0
Taer4g01337 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 87.16 1.13e-168 465.0
Taer4g01648 WGDA 1 81 Cytoplasmic Ribosomal Protein gene family AT5G27700 83.951 7.62e-50 151.0
Taer4g02381 ACH 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 85.484 9.40e-120 335.0
Taer4g02387 ACH 1 124 Cytoplasmic Ribosomal Protein gene family AT3G05560 82.54 1.06e-61 183.0
Taer4g02512 . 5 114 Cytoplasmic Ribosomal Protein gene family AT2G09990 79.091 1.49e-61 187.0
Taer4g02517 ACH 14 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.167 1.17e-77 223.0
Taer4g02519 ACH 38 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 80.208 2.53e-49 154.0
Taer4g02526 ACH 1 152 Cytoplasmic Ribosomal Protein gene family AT4G09800 95.395 7.75e-108 301.0
Taer4g02530 . 1 277 Cytoplasmic Ribosomal Protein gene family AT3G09200 85.199 1.65e-175 486.0
Taer4g02641 ACH 1 130 Cytoplasmic Ribosomal Protein gene family AT4G27090 86.923 1.94e-78 228.0
Taer4g02657 . 1 140 Cytoplasmic Ribosomal Protein gene family AT3G04400 97.857 3.07e-99 280.0
Taer4g02702 ACH 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 3.03e-137 380.0
Taer4g02739 . 1 133 Cytoplasmic Ribosomal Protein gene family AT4G18100 84.211 1.83e-82 237.0
Taer4g02787 . 1 292 Cytoplasmic Ribosomal Protein gene family AT3G25520 82.192 0.0 503.0
Taer4g02820 ACH 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 7.30e-145 402.0
Taer4g02833 . 1 113 Cytoplasmic Ribosomal Protein gene family AT2G40590 79.646 2.47e-62 185.0
Taer4g02973 ACH 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 4.45e-92 262.0
Taer4g03067 . 1 122 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.623 4.27e-80 231.0
Taer5g00080 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 5.60e-47 157.0
Taer5g00129 . 95 250 Cytoplasmic Ribosomal Protein gene family AT1G58380 29.091 2.19e-14 70.9
Taer5g00199 ACH 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Taer5g00290 . 2 151 Cytoplasmic Ribosomal Protein gene family AT1G29970 43.293 1.94e-30 106.0
Taer5g00291 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 87.5 2.44e-119 333.0
Taer5g00388 WGDA 1 224 Cytoplasmic Ribosomal Protein gene family AT2G31610 90.625 1.23e-150 421.0
Taer5g00468 WGDA 5 77 Cytoplasmic Ribosomal Protein gene family AT3G62250 30.137 3.23e-06 45.4
Taer5g00542 ACH,WGDA 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.56e-126 353.0
Taer5g00626 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 1.92e-08 51.2
Taer5g00705 ACH 1 62 Cytoplasmic Ribosomal Protein gene family AT5G64140 92.063 6.67e-35 113.0
Taer5g00958 WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G02560 75.916 3.30e-111 313.0
Taer5g01284 . 1 56 Cytoplasmic Ribosomal Protein gene family AT4G33865 92.857 2.67e-35 112.0
Taer5g01306 . 5 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 85.211 1.93e-90 257.0
Taer5g01525 . 1 158 Cytoplasmic Ribosomal Protein gene family AT1G29970 38.994 2.13e-31 108.0
Taer5g01917 . 2 74 Cytoplasmic Ribosomal Protein gene family AT3G52590 44.595 2.37e-10 57.4
Taer5g02329 . 1 107 Cytoplasmic Ribosomal Protein gene family AT5G59850 69.159 3.44e-46 144.0
Taer5g02334 ACH 1 180 Cytoplasmic Ribosomal Protein gene family AT2G42740 93.889 2.27e-127 353.0
Taer5g02422 . 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 84.951 4.98e-112 318.0
Taer5g02489 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G00100 92.715 3.46e-101 285.0
Taer5g02571 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 63.158 3.03e-42 132.0
Taer5g02596 ACH 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 1.46e-56 181.0
Taer5g02694 . 8 106 Cytoplasmic Ribosomal Protein gene family AT2G37600 88.889 1.66e-57 173.0
Taer5g02794 . 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 69.369 1.38e-32 115.0
Taer5g02874 WGDA 10 67 Cytoplasmic Ribosomal Protein gene family AT2G34480 79.31 1.45e-28 99.0
Taer5g03321 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 3.02e-77 222.0
Taer5g03323 . 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.84e-126 352.0
Taer5g03413 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Taer5g03466 . 79 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 91.071 1.65e-29 99.8
Taer6g00384 WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 1.96e-91 259.0
Taer6g00502 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 86.932 4.00e-119 332.0
Taer6g00780 . 1 186 Cytoplasmic Ribosomal Protein gene family AT5G27850 86.022 2.68e-120 337.0
Taer6g00866 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 9.99e-85 243.0
Taer6g01015 ACH,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 88.35 1.23e-136 379.0
Taer6g01304 WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Taer6g01356 ACH 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 9.50e-93 262.0
Taer6g01440 . 1 287 Cytoplasmic Ribosomal Protein gene family AT2G40010 75.61 1.77e-160 449.0
Taer6g02045 ACH,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Taer6g02073 ACH 1 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 79.259 2.29e-79 228.0
Taer6g02152 ACH,WGDA 1 123 Cytoplasmic Ribosomal Protein gene family AT2G39390 90.244 9.74e-74 214.0
Taer6g02236 ACH,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G07070 91.071 3.11e-75 216.0
Taer6g02374 ACH,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 4.20e-126 352.0
Taer6g02794 ACH 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 89.157 2.22e-108 304.0
Taer6g02829 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.544 9.09e-34 112.0
Taer6g03633 . 60 154 Cytoplasmic Ribosomal Protein gene family AT2G39460 48.421 8.58e-23 88.2
Taer6g03966 ACH 127 199 Cytoplasmic Ribosomal Protein gene family AT2G47610 28.767 6.18e-06 43.1
Taer6g04052 WGDA 1 189 Cytoplasmic Ribosomal Protein gene family AT3G02560 75.132 1.88e-108 308.0
Taer6g04160 WGDA 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 90.857 2.88e-120 337.0
Taer6g04217 WGDA 1 71 Cytoplasmic Ribosomal Protein gene family AT3G62250 41.892 1.23e-06 46.2
Taer7g00033 WGDA 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 82.988 6.43e-151 418.0
Taer7g00062 . 1 152 Cytoplasmic Ribosomal Protein gene family AT1G29970 43.506 3.99e-34 115.0
Taer7g00246 ACH,WGDA 1 143 Cytoplasmic Ribosomal Protein gene family AT4G29410 73.427 6.82e-75 218.0
Taer7g00315 ACH,WGDA 12 254 Cytoplasmic Ribosomal Protein gene family AT1G72370 81.967 4.59e-146 416.0
Taer7g00520 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 4.12e-69 203.0
Taer7g00567 WGDA 1 51 Cytoplasmic Ribosomal Protein gene family AT4G31985 94.118 2.04e-31 102.0
Taer7g00634 WGDA 126 203 Cytoplasmic Ribosomal Protein gene family AT3G62870 30.769 4.19e-06 43.9
Taer7g00801 . 85 149 Cytoplasmic Ribosomal Protein gene family AT1G29970 34.722 5.92e-07 48.5
Taer7g00972 . 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 71.069 2.94e-76 222.0
Taer7g01230 ACH,WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 82.723 1.89e-114 324.0
Taer7g01392 WGDA 23 121 Cytoplasmic Ribosomal Protein gene family AT5G62300 31.0 1.04e-07 47.4
Taer7g01403 . 1 196 Cytoplasmic Ribosomal Protein gene family AT5G59240 85.024 9.26e-126 355.0
Taer7g01450 ACH 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 92.248 0.0 498.0
Taer7g01566 . 4 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 82.988 1.79e-150 420.0
Taer7g01636 . 1 146 Cytoplasmic Ribosomal Protein gene family AT2G09990 81.507 5.36e-87 248.0
Taer7g01801 ACH 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Taer7g02237 WGDA 5 150 Cytoplasmic Ribosomal Protein gene family AT5G09500 88.356 5.46e-93 264.0
Taer7g02334 . 1 159 Cytoplasmic Ribosomal Protein gene family AT4G30800 91.824 3.03e-97 275.0
Taer7g02395 . 1 112 Cytoplasmic Ribosomal Protein gene family AT1G36240 88.393 1.06e-71 209.0
Taer7g02427 . 1 92 Cytoplasmic Ribosomal Protein gene family AT3G10950 93.478 7.65e-60 176.0
Taer7g02435 WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT4G34670 87.405 2.41e-164 455.0
Taer7g02664 ACH 1 69 Cytoplasmic Ribosomal Protein gene family AT3G59540 95.652 3.73e-44 137.0
Taer7g02970 . 61 168 Cytoplasmic Ribosomal Protein gene family AT5G39850 84.259 9.93e-67 200.0
Taer8g00080 . 1 139 Cytoplasmic Ribosomal Protein gene family AT2G44860 74.101 1.56e-76 223.0
Taer8g00142 WGDA 127 182 Cytoplasmic Ribosomal Protein gene family AT2G47610 35.714 3.10e-06 43.1
Taer8g00200 WGDA 1 51 Cytoplasmic Ribosomal Protein gene family AT4G31985 94.118 5.70e-32 104.0
Taer8g00236 ACH,WGDA 1 105 Cytoplasmic Ribosomal Protein gene family AT4G14320 94.286 2.97e-69 200.0
Taer8g00405 ACH,WGDA 12 257 Cytoplasmic Ribosomal Protein gene family AT1G72370 80.488 3.36e-145 411.0
Taer8g00451 ACH,WGDA 1 142 Cytoplasmic Ribosomal Protein gene family AT4G29410 73.239 1.46e-74 217.0
Taer8g00587 ACH,WGDA 5 244 Cytoplasmic Ribosomal Protein gene family AT3G13580 85.0 2.70e-153 425.0
Taer8g00602 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.928 2.76e-92 262.0
Taer8g00605 . 1 139 Cytoplasmic Ribosomal Protein gene family AT3G52580 89.928 1.60e-92 265.0
Taer8g00645 . 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 6.20e-53 162.0
Taer8g00786 . 1 159 Cytoplasmic Ribosomal Protein gene family AT5G23740 89.308 2.84e-96 273.0
Taer8g00902 . 1 121 Cytoplasmic Ribosomal Protein gene family AT3G47370 92.562 3.02e-80 229.0
Taer8g01457 . 1 151 Cytoplasmic Ribosomal Protein gene family AT4G25740 82.051 5.95e-84 243.0
Taer8g01494 . 1 153 Cytoplasmic Ribosomal Protein gene family AT2G36620 88.312 1.14e-86 249.0
Taer8g01610 ACH 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 4.20e-126 352.0
Taer8g01763 ACH 1 112 Cytoplasmic Ribosomal Protein gene family AT1G74270 91.964 4.63e-75 218.0
Taer8g01834 ACH 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 88.312 2.39e-75 220.0
Taer8g01853 ACH 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 90.164 4.48e-73 211.0
Taer8g01980 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.711 1.08e-108 304.0
Taer8g02079 . 1 175 Cytoplasmic Ribosomal Protein gene family AT1G67430 91.525 2.75e-120 337.0
Taer8g02153 ACH 1 86 Cytoplasmic Ribosomal Protein gene family AT3G61110 95.349 2.21e-59 174.0
Taer8g02166 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 91.667 4.73e-76 223.0
Taer8g02174 . 1 218 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.615 8.95e-146 403.0
Taer8g02410 . 49 146 Cytoplasmic Ribosomal Protein gene family AT1G23290 56.122 2.59e-27 95.1
Taer8g02719 . 5 110 Cytoplasmic Ribosomal Protein gene family AT2G40010 40.179 5.61e-22 87.4
Taer8g02802 ACH 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Taer8g02840 ACH 2 135 Cytoplasmic Ribosomal Protein gene family AT4G15000 80.597 2.76e-79 228.0
Taer9g00037 . 1 82 Cytoplasmic Ribosomal Protein gene family AT3G52590 40.244 1.27e-09 55.1
Taer9g00041 WGDA 1 194 Cytoplasmic Ribosomal Protein gene family AT1G33140 82.474 8.95e-119 333.0
Taer9g00068 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 3.40e-46 157.0
Taer9g00069 . 1 77 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.701 3.32e-47 156.0
Taer9g00281 . 15 77 Cytoplasmic Ribosomal Protein gene family AT3G62250 47.619 2.80e-10 52.8
Taer9g00363 ACH,WGDA 1 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 89.815 4.92e-130 363.0
Taer9g00434 ACH,WGDA 1 166 Cytoplasmic Ribosomal Protein gene family AT2G37190 88.554 1.79e-107 302.0
Taer9g00614 . 1 71 Cytoplasmic Ribosomal Protein gene family AT3G52590 37.838 1.87e-08 50.8
Taer9g00758 WGDA 3 178 Cytoplasmic Ribosomal Protein gene family AT2G34480 88.068 1.32e-119 335.0
Taer9g00935 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 60.0 2.91e-38 124.0
Taer9g00983 . 28 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 83.981 1.81e-111 316.0
Taer9g01269 WGDA 1 262 Cytoplasmic Ribosomal Protein gene family AT5G58420 89.313 0.0 500.0
Taer9g01504 ACH,WGDA 1 133 Cytoplasmic Ribosomal Protein gene family AT5G28060 89.552 4.77e-85 244.0
Taer9g01755 ACH 1 220 Cytoplasmic Ribosomal Protein gene family AT1G26910 87.273 6.44e-145 401.0
Taer9g01903 . 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 98.462 1.32e-92 264.0
Taer9g02103 . 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 86.076 2.51e-146 409.0
Taer9g02137 . 1 69 Cytoplasmic Ribosomal Protein gene family AT5G57290 76.812 6.40e-31 105.0
Taer9g02473 . 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 7.16e-65 192.0
Taer9g02701 . 1 233 Cytoplasmic Ribosomal Protein gene family AT1G74050 82.833 1.26e-124 353.0
Taer9g02890 . 99 221 Cytoplasmic Ribosomal Protein gene family AT3G51190 39.837 2.98e-21 87.0
Taer9g03116 . 1 120 Cytoplasmic Ribosomal Protein gene family AT1G26880 92.5 4.58e-78 224.0
Taer9g03117 ACH 1 187 Cytoplasmic Ribosomal Protein gene family AT5G39850 89.305 1.54e-126 353.0
Taer9g03160 . 1 152 Cytoplasmic Ribosomal Protein gene family AT3G62250 96.053 7.13e-108 302.0
Taer10g00146 ACH,WGDA 1 204 Cytoplasmic Ribosomal Protein gene family AT4G16720 89.706 1.63e-126 355.0
Taer10g00327 ACH,WGDA 1 112 Cytoplasmic Ribosomal Protein gene family AT1G07070 92.857 4.75e-76 219.0
Taer10g00432 ACH 1 154 Cytoplasmic Ribosomal Protein gene family AT3G55280 87.013 4.77e-70 209.0
Taer10g00439 ACH,WGDA 1 122 Cytoplasmic Ribosomal Protein gene family AT2G39390 90.164 1.33e-73 214.0
Taer10g00539 . 5 145 Cytoplasmic Ribosomal Protein gene family AT5G09500 87.234 2.73e-88 252.0
Taer10g00642 ACH,WGDA 1 108 Cytoplasmic Ribosomal Protein gene family AT4G39200 88.889 1.48e-54 164.0
Taer10g00932 ACH,WGDA 1 111 Cytoplasmic Ribosomal Protein gene family AT3G44590 67.857 7.35e-31 115.0
Taer10g00938 ACH 66 216 Cytoplasmic Ribosomal Protein gene family AT1G08360 93.377 1.46e-86 250.0
Taer10g01327 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT3G49910 79.47 1.12e-81 235.0
Taer10g01463 WGDA 1 70 Cytoplasmic Ribosomal Protein gene family AT3G52590 31.429 1.55e-07 48.9
Taer10g01633 . 1 249 Cytoplasmic Ribosomal Protein gene family AT5G10360 89.96 8.54e-165 454.0
Taer10g01644 ACH 3 406 Cytoplasmic Ribosomal Protein gene family AT3G09630 80.941 0.0 672.0
Taer10g01829 . 1 76 Cytoplasmic Ribosomal Protein gene family AT3G52590 100.0 1.32e-48 155.0
Taer10g01911 . 1 164 Cytoplasmic Ribosomal Protein gene family AT1G09690 82.317 6.29e-100 285.0
Taer11g00129 WGDA 1 386 Cytoplasmic Ribosomal Protein gene family AT1G43170 89.637 0.0 714.0
Taer11g00239 ACH 1 94 Cytoplasmic Ribosomal Protein gene family AT3G52590 27.358 2.95e-06 44.7
Taer11g00372 ACH,WGDA 1 258 Cytoplasmic Ribosomal Protein gene family AT4G36130 92.248 0.0 497.0
Taer11g00426 WGDA 23 144 Cytoplasmic Ribosomal Protein gene family AT2G32060 72.951 6.04e-64 191.0
Taer11g00539 ACH,WGDA 1 146 Cytoplasmic Ribosomal Protein gene family AT1G70600 85.616 1.40e-92 264.0
Taer11g00751 ACH,WGDA 1 256 Cytoplasmic Ribosomal Protein gene family AT3G62870 88.716 8.01e-174 477.0
Taer11g00752 . 1 70 Cytoplasmic Ribosomal Protein gene family AT3G62250 38.028 1.68e-08 53.9
Taer11g01447 WGDA 1 191 Cytoplasmic Ribosomal Protein gene family AT3G49010 82.723 6.03e-117 331.0
Taer11g01451 . 1 129 Cytoplasmic Ribosomal Protein gene family AT2G19720 74.419 1.99e-75 218.0
Taer11g01523 WGDA 1 95 Cytoplasmic Ribosomal Protein gene family AT1G15250 89.474 6.42e-59 174.0
Taer11g01794 . 13 82 Cytoplasmic Ribosomal Protein gene family AT3G06680 74.286 3.28e-32 107.0
Taer11g01928 . 1 130 Cytoplasmic Ribosomal Protein gene family AT5G59850 97.692 2.20e-92 265.0
Taer11g01956 WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 2.08e-91 260.0
Taer11g01986 . 48 284 Cytoplasmic Ribosomal Protein gene family AT1G58983 86.076 2.36e-140 413.0
Taer11g02152 ACH,WGDA 1 206 Cytoplasmic Ribosomal Protein gene family AT5G48760 87.864 7.77e-137 379.0
Taer11g02185 ACH 1 134 Cytoplasmic Ribosomal Protein gene family AT4G27090 85.821 1.82e-80 231.0
Taer11g02494 . 1 239 Cytoplasmic Ribosomal Protein gene family AT2G31610 86.25 1.85e-151 420.0
Taer11g02563 WGDA 1 128 Cytoplasmic Ribosomal Protein gene family AT3G52590 98.438 8.47e-92 259.0
Taer11g02620 . 15 128 Cytoplasmic Ribosomal Protein gene family AT4G18730 28.226 1.81e-06 45.8
Taer11g02761 . 1 111 Cytoplasmic Ribosomal Protein gene family AT5G24510 63.158 3.17e-41 131.0
Taer12g00808 . 74 144 Cytoplasmic Ribosomal Protein gene family AT4G30800 38.028 4.71e-06 41.2