AGRP Logo

AGRP

Asteraceae Genomic Research Platform

Gene Search

Example:
Example:

Gene details

leaf

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Taer6g01118 ATGAATGATAGTTCCCTTAACGTTGCGTTGCGGGATTCCTTGCGCAACACATGTGGAAATGTTAGATTTCCAGTTTCCAAAACTTCAAACTTTAAGGTCCCACATATCCATACACGTGTCACCACTGGTCATCATCTTCTTGTTCAATCTCTGCAATTCACTCATTTCCACTGCCATACCACCATCCTCCATTGTTGGTCATCCATGGCTTTCACCATTGCTTCCACTTCCCATTCATCCCTCCCAACCAGGAGAGAATATTTCAAGAAACCACCTTATGCTGAAAGAAGTTGTACTCCAAGGTACTTGTTCAGAAGCAGCAATGTTCAGAAGCTAAAAGCAGCTAAAGAAGGTGTATCAAGTGTATGTGAACCACTTCCTGCTGACAGACCAGTATGGTTCCCAGGAACTTCACCTCCTCAATGGCTTGATGGCAGCCTCCCTGGAGATTTTGGCTTTGACCCACTTGGATTAGGGTCTGATCCTGAAACACTCAAATGGTTTGCACAAGCTGAGTTGATGCACAGCAGATGGGCAATGCTTGCAGTTGCTGGTATTTTGATCCCAGAATGGCTGGAAGGTTTGGGCTTTATTGATAACTTTTCGTGGTTCGAAGCTGGGTCTAGGGAATACTTTGCTGACCCGACGACGTTATTTGTGGTGCAAATGGCGTTGATGGGTTGGGTTGAGGGTCGAAGATGGGCCGACATGATCAACCCTGGGTGCGTTGACATTGAGCCTAAGCTTCCTAATAAGAAGAAACCAAAGCCCGATGTTGGGTACCCAGGGGGATTGTGGTTTGATCCGTTTATGTGGGGAAGGGGGTCTCCAGAACCGGTGATGGTTTTGAGGACCAAAGAAATAAAGAACGGGCGGTTAGCCATGCTGGCATTTACGGGTTTTGTGTTCCAAGCCATTTACACTGGGCAAAGTCCGCTTGAGAACCTATCGGCTCACCTTGCGGACCCTGGTCACGTCAACATTTTCTCGGCCTTCAGCAGCCAAATTCAATGA 1014 47.24 MNDSSLNVALRDSLRNTCGNVRFPVSKTSNFKVPHIHTRVTTGHHLLVQSLQFTHFHCHTTILHCWSSMAFTIASTSHSSLPTRREYFKKPPYAERSCTPRYLFRSSNVQKLKAAKEGVSSVCEPLPADRPVWFPGTSPPQWLDGSLPGDFGFDPLGLGSDPETLKWFAQAELMHSRWAMLAVAGILIPEWLEGLGFIDNFSWFEAGSREYFADPTTLFVVQMALMGWVEGRRWADMINPGCVDIEPKLPNKKKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFTGFVFQAIYTGQSPLENLSAHLADPGHVNIFSAFSSQIQ* 338
leaf

Annotation information

Select Seq ID Length Analysis Description Start End IPR GO
Taer6g01118 337 Pfam Chlorophyll A-B binding protein 139 306 IPR022796 -
Taer6g01118 337 FunFam Chlorophyll a-b binding protein, chloroplastic 140 325 - -
Taer6g01118 337 PANTHER CHLOROPHYLL A-B BINDING PROTEIN 89 329 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Taer6g01118 337 SUPERFAMILY Chlorophyll a-b binding protein 129 333 - -
Taer6g01118 337 Gene3D Chlorophyll a-b binding protein domain 140 325 - -
leaf

Pathway information

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Taer6g01118 K08908 light-harvesting complex I chlorophyll a/b binding protein 2
leaf

Duplication type information

Select Gene1 Location1 Gene2 Location2 Duplicated-type
Taer Taer-Chr1:50631684 Taer6g01118 Taer-Chr6:7603672 dispersed
Taer Taer-Chr2:99781667 Taer6g01118 Taer-Chr6:7603672 dispersed
Taer Taer-Chr6:7603672 Taer6g03931 Taer-Chr6:58444384 dispersed
Taer Taer-Chr6:7603672 Taer11g02420 Taer-Chr11:35634438 transposed
Taer Taer-Chr6:7603672 Taer1g03948 Taer-Chr1:39711939 transposed
leaf

Gene Family Members

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Taer1g01428 WGDA 2 265 Chloroplast and Mitochondria gene family AT2G05100 67.79 2.52e-122 351.0
Taer1g01596 WGDA 55 255 Chloroplast and Mitochondria gene family AT3G61470 55.721 8.20e-75 226.0
Taer1g02406 . 93 254 Chloroplast and Mitochondria gene family AT3G61470 74.074 2.51e-80 239.0
Taer1g03419 . 1 227 Chloroplast and Mitochondria gene family AT1G26100 61.135 6.02e-84 248.0
Taer1g03423 . 1 227 Chloroplast and Mitochondria gene family AT1G26100 61.135 4.74e-84 248.0
Taer1g03948 WGDA 45 254 Chloroplast and Mitochondria gene family AT3G61470 95.238 1.35e-150 419.0
Taer1g04318 . 84 354 Chloroplast and Mitochondria gene family AT2G28800 20.069 1.05e-07 52.4
Taer1g04772 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 64.035 2.88e-107 307.0
Taer1g05541 . 18 273 Chloroplast and Mitochondria gene family AT1G61520 88.672 3.18e-172 474.0
Taer1g06404 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 38.246 4.88e-50 166.0
Taer1g06766 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 83.226 1.23e-177 495.0
Taer1g06767 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 83.226 8.14e-179 497.0
Taer1g06804 ACH 6 373 Chloroplast and Mitochondria gene family AT5G14040 78.804 0.0 577.0
Taer1g07386 . 1 301 Chloroplast and Mitochondria gene family AT4G25700 64.353 1.32e-144 408.0
Taer2g02118 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 73.885 3.13e-178 494.0
Taer2g02119 . 7 320 Chloroplast and Mitochondria gene family AT5G15640 70.701 1.22e-170 474.0
Taer2g02584 WGDA 3 280 Chloroplast and Mitochondria gene family AT4G10340 83.63 8.72e-155 431.0
Taer2g02678 . 38 254 Chloroplast and Mitochondria gene family AT3G61470 45.0 1.16e-58 186.0
Taer2g03159 ACH 1 365 Chloroplast and Mitochondria gene family AT5G14040 69.399 0.0 506.0
Taer2g03420 . 5 345 Chloroplast and Mitochondria gene family AT1G72820 66.959 5.92e-169 473.0
Taer4g00939 . 1 328 Chloroplast and Mitochondria gene family AT2G30160 71.299 5.30e-167 466.0
Taer4g00962 . 1 72 Chloroplast and Mitochondria gene family AT5G05370 63.889 6.92e-31 104.0
Taer4g01028 . 38 270 Chloroplast and Mitochondria gene family AT4G03320 35.443 1.70e-41 143.0
Taer4g02335 . 37 309 Chloroplast and Mitochondria gene family AT1G25380 26.769 1.08e-30 118.0
Taer4g02369 . 1 307 Chloroplast and Mitochondria gene family AT2G47490 77.922 5.77e-167 464.0
Taer4g02969 . 50 405 Chloroplast and Mitochondria gene family AT2G28800 82.451 0.0 600.0
Taer5g00315 . 1 267 Chloroplast and Mitochondria gene family AT1G29930 77.239 2.20e-142 397.0
Taer5g00316 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 85.821 4.00e-169 467.0
Taer5g00317 . 1 266 Chloroplast and Mitochondria gene family AT2G34430 86.94 1.32e-170 470.0
Taer5g00475 ACH 1 303 Chloroplast and Mitochondria gene family AT2G17270 66.997 2.16e-160 447.0
Taer5g00691 ACH 2 373 Chloroplast and Mitochondria gene family AT5G14040 77.419 0.0 574.0
Taer5g02876 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 87.266 9.68e-171 470.0
Taer5g03006 WGDA 6 224 Chloroplast and Mitochondria gene family AT5G38630 39.269 1.25e-53 170.0
Taer6g00431 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 88.806 1.14e-173 478.0
Taer6g01118 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 65.217 9.98e-100 293.0
Taer6g01571 . 47 548 Chloroplast and Mitochondria gene family AT2G18710 82.051 0.0 835.0
Taer6g03832 WGDA 1 280 Chloroplast and Mitochondria gene family AT4G10340 83.688 2.74e-148 414.0
Taer6g03931 . 51 257 Chloroplast and Mitochondria gene family AT3G61470 65.217 1.98e-100 292.0
Taer7g00402 ACH,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.942 1.45e-169 474.0
Taer7g01015 . 1 258 Chloroplast and Mitochondria gene family AT1G15820 82.171 8.20e-152 422.0
Taer7g01550 . 1 265 Chloroplast and Mitochondria gene family AT2G05100 88.302 6.30e-179 491.0
Taer7g01551 . 1 265 Chloroplast and Mitochondria gene family AT2G05070 88.302 3.12e-179 491.0
Taer7g01729 ACH 6 343 Chloroplast and Mitochondria gene family AT1G72820 67.353 1.02e-151 428.0
Taer7g03473 . 33 327 Chloroplast and Mitochondria gene family AT1G25380 66.445 9.79e-143 406.0
Taer8g00329 ACH,WGDA 1 343 Chloroplast and Mitochondria gene family AT1G72820 69.388 7.34e-166 467.0
Taer8g00430 . 1 187 Chloroplast and Mitochondria gene family AT1G17530 61.497 8.69e-72 213.0
Taer8g02034 . 72 407 Chloroplast and Mitochondria gene family AT2G28800 63.128 6.54e-157 454.0
Taer8g02543 . 1 224 Chloroplast and Mitochondria gene family AT1G14730 58.036 1.23e-90 264.0
Taer9g00669 WGDA 4 211 Chloroplast and Mitochondria gene family AT4G25570 39.423 1.45e-54 173.0
Taer9g00757 WGDA 1 267 Chloroplast and Mitochondria gene family AT1G29930 86.517 4.43e-170 468.0
Taer9g01216 . 14 287 Chloroplast and Mitochondria gene family AT5G01530 82.482 6.29e-159 442.0
Taer9g02530 . 2 364 Chloroplast and Mitochondria gene family AT5G14040 72.922 0.0 546.0
Taer10g00078 . 1 239 Chloroplast and Mitochondria gene family AT4G25570 63.598 2.24e-107 308.0
Taer10g00988 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.365 0.0 506.0
Taer10g00996 WGDA 1 307 Chloroplast and Mitochondria gene family AT5G40810 84.365 0.0 505.0
Taer10g01182 ACH 1 228 Chloroplast and Mitochondria gene family AT5G38630 67.982 8.32e-116 328.0
Taer10g01385 WGDA 29 300 Chloroplast and Mitochondria gene family AT2G47490 38.929 1.76e-50 168.0
Taer10g01659 . 33 294 Chloroplast and Mitochondria gene family AT1G25380 26.95 1.14e-12 66.2
Taer11g00389 . 1 354 Chloroplast and Mitochondria gene family AT5G54290 69.274 1.33e-148 421.0
Taer11g00460 ACH 1 367 Chloroplast and Mitochondria gene family AT5G14040 71.117 0.0 538.0
Taer11g00635 WGDA 55 250 Chloroplast and Mitochondria gene family AT3G61470 57.653 1.71e-75 229.0
Taer11g02420 WGDA 32 254 Chloroplast and Mitochondria gene family AT3G61470 91.031 4.49e-151 420.0
Taer12g00849 . 40 325 Chloroplast and Mitochondria gene family AT1G76570 76.923 2.10e-168 469.0